KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL2261
Entry
SACOL2261         CDS       T00225                                 

Gene name
moaA
Definition
(GenBank) molybdenum cofactor biosynthesis protein A
  KO
K03639  GTP 3',8-cyclase [EC:4.1.99.22]
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Pathway
sac00790  Folate biosynthesis
sac01100  Metabolic pathways
sac01240  Biosynthesis of cofactors
sac04122  Sulfur relay system
Module
sac_M00880  Molybdenum cofactor biosynthesis, GTP => molybdenum cofactor
Brite
KEGG Orthology (KO) [BR:sac00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SACOL2261 (moaA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    SACOL2261 (moaA)
Enzymes [BR:sac01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.22  GTP 3',8-cyclase
     SACOL2261 (moaA)
SSDB
Motif
Pfam: Mob_synth_C Radical_SAM Fer4_14 Fer4_12 Radical_SAM_2 DUF520 DNA_primase_lrg DUF3194
Other DBs
NCBI-ProteinID: AAW37133
UniProt: Q5HDT9
Structure
PDB: 
1TV8 2FB2 2FB3 1TV7

Position
complement(2325391..2326413)
AA seq 340 aa
MVEQIKDKLGRPIRDLRLSVTDRCNFRCDYCMPKEVFGDDFVFLPKNELLTFDEMARIAK
VYAELGVKKIRITGGEPLMRRDLDVLIAKLNQIDGIEDIGLTTNGLLLKKHGQKLYDAGL
RRINVSLDAIDDTLFQSINNRNIKATTILEQIDYATSIGLNVKVNVVIQKGINDDQIIPM
LEYFKDKHIEIRFIEFMDVGNDNGWDFSKVVTKDEMLTMIEQHFEIDPVEPKYFGEVAKY
YRHKDNGVQFGLITSVSQSFCSTCTRARLSSDGKFYGCLFATVDGFNVKAFIRSGVTDEE
LKEQFKALWQIRDDRYSDERTAQTVANRQRKKINMNYIGG
NT seq 1023 nt   +upstreamnt  +downstreamnt
atggtagaacaaataaaagataaactaggacgtcccatccgtgacttacggttatctgtg
acagatcggtgtaactttaggtgtgattattgcatgcctaaagaggtatttggagatgat
ttcgtatttttacctaaaaatgaacttttaacgtttgatgaaatggctagaatcgctaag
gtatatgcagaattaggtgtaaaaaaaatacgcattacaggtggagaaccattgatgcga
cgggatttagatgtacttatagctaaattaaatcaaatcgatggtattgaagatattggt
ttgactacaaatggtttgttattaaaaaagcatggacaaaagttatatgatgctgggctg
cgcagaattaatgtcagtttggatgctattgatgatacgctatttcaatcaatcaataat
cgtaatattaaagcgactacgattttagaacaaattgattacgcgacgtctattggtttg
aatgtaaaagtaaatgttgttatacaaaaaggtattaacgatgatcaaatcataccaatg
cttgaatattttaaagataaacatatagagattcgatttatagaatttatggatgttggt
aatgataatggatgggatttcagtaaagttgtaactaaagatgaaatgcttacaatgata
gagcagcactttgaaatcgatcctgtagaaccaaaatattttggggaagtagcaaaatat
tatcgccataaggataatggtgttcaatttggtttgattacaagtgtttcacaatcattt
tgttctacatgtacacgcgcaaggctgtcatcagatgggaagttttacggatgtttattt
gcaactgtcgatggatttaacgttaaagcgtttattcgttctggcgtgaccgacgaagaa
ttaaaagaacaatttaaagctttatggcaaataagagatgatcgatattcagatgagaga
actgctcaaacagttgccaatcgtcaacgtaaaaagataaacatgaattatattggtggt
taa

DBGET integrated database retrieval system