KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL2263
Entry
SACOL2263         CDS       T00225                                 

Gene name
moaD
Definition
(GenBank) molybdopterin converting factor, subunit 1
  KO
K03636  sulfur-carrier protein
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Pathway
sac04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:sac00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    SACOL2263 (moaD)
SSDB
Motif
Pfam: ThiS
Other DBs
NCBI-ProteinID: AAW37135
UniProt: A0A0H2WWS9
Structure
PDB: 
2Q5W 2QIE

Position
complement(2327039..2327272)
AA seq 77 aa
MKVLYFAEIKDILQKAQEDIVLEQALTVQQFEDLLFERYPQINNKKFQVAVNEEFVQKSD
FIQPNDTVALIPPVSGG
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaaggtactttacttcgcagaaattaaagatatattacaaaaagcacaggaagatatt
gtgcttgaacaagcattgactgtacaacaatttgaagatttattgtttgaacgttatccg
caaatcaataataaaaagtttcaagttgctgtaaatgaggaatttgtacaaaaatcggat
ttcattcaacctaatgatactgttgcattaattccaccggttagtggaggttaa

DBGET integrated database retrieval system