KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL2267
Entry
SACOL2267         CDS       T00225                                 

Gene name
moaC
Definition
(GenBank) molybdenum cofactor biosynthesis protein C
  KO
K03637  cyclic pyranopterin monophosphate synthase [EC:4.6.1.17]
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Pathway
sac00790  Folate biosynthesis
sac01100  Metabolic pathways
sac01240  Biosynthesis of cofactors
sac04122  Sulfur relay system
Module
sac_M00880  Molybdenum cofactor biosynthesis, GTP => molybdenum cofactor
Brite
KEGG Orthology (KO) [BR:sac00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SACOL2267 (moaC)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    SACOL2267 (moaC)
Enzymes [BR:sac01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.17  cyclic pyranopterin monophosphate synthase
     SACOL2267 (moaC)
SSDB
Motif
Pfam: MoaC
Other DBs
NCBI-ProteinID: AAW38487
UniProt: Q5HDT3
Position
2329542..2330036
AA seq 164 aa
MTEFTHINQQGHAKMVDVSDKQITKRTAVAHSSITVNETIFKQISNNTNTKGNVLNTAQI
AGIMAAKNTSTLIPMCHPLPLTGIDVHFSWDETNAPLYTLNIQTTVSTTGKTGVEMEALT
AASATALTIYDMTKAVDKGMIIGETYLESKSGGKSGDFQRQSNQ
NT seq 495 nt   +upstreamnt  +downstreamnt
atgactgagtttactcatattaatcaacaaggccacgccaaaatggtcgatgtatcagac
aaacaaattacaaaaagaactgctgtcgctcattcaagcattactgtaaatgaaactatt
tttaagcagatttctaataacaccaataccaaaggcaatgtattgaacactgctcaaatc
gctggtattatggctgccaaaaatacatcaacacttattccgatgtgccatccattacca
ttgactggcatagatgttcacttcagctgggatgaaacaaatgcacccctttatacttta
aacattcaaacaactgtctctacaactggcaaaaccggtgttgaaatggaagctttaacc
gctgcatcagcaacggctttaaccatttacgacatgacgaaagcagttgataaaggtatg
attattggcgaaacctaccttgaaagcaagtctggcggtaaatctggagattttcaacgc
caatcaaatcaataa

DBGET integrated database retrieval system