KEGG   Sulfurihydrogenibium azorense: SULAZ_0523
Entry
SULAZ_0523        CDS       T00876                                 

Definition
(GenBank) pyruvate carboxylase subunit B (Pyruvic carboxylase B)
  KO
K20140  2-oxoglutarate carboxylase large subunit [EC:6.4.1.7]
Organism
saf  Sulfurihydrogenibium azorense
Brite
KEGG Orthology (KO) [BR:saf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SULAZ_0523
Enzymes [BR:saf01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.7  2-oxoglutarate carboxylase
     SULAZ_0523
SSDB
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 RnfC_N HlyD_D23 HlyD_3 GCV_H Peptidase_M23 DUF2118 PTS_EIIA_1 NQRA
Other DBs
NCBI-ProteinID: ACN98622
UniProt: C1DTS7
Position
complement(467008..468951)
AA seq 647 aa
MNIKLFKDLLQQGNLEVAPPKPIKITDLTPRDGQQCKLATRVRTDDLLPLCEKMDKAGFY
AVEVWGGATFDVCLRYLKEDPWERLKRIKEVMPRTKLQMLFRGQNIVGYKPKSDKVVKKF
VEKAIEHGITVFRVFDSLNDNRNIEVAVKAIKEFGGEVHAEISYTKSPVHTLEKWMSYAD
ELIDLEPDWICFKDATGILMPEDTYNIIRGIKQKIKEKANDRIKLVLHNHDMSGTAIMNH
MMAILAGVDMVDTVLSPLAFGSSHPATESVVAALKDTPYDTGLDLKVLDELAEITREIKK
KYKKYETEYAGVNAKVLIHKIPGGMISNMVAQLMEANALDKMEEALEEVPNVERDLGYPP
LLTPSSQIVGVQAVLNVISGERYKIITKEVRDYVEGKYGKPPGPISKELAEKILGPGKEP
DFSIRAGDLADKEEWEKAYNEVKLILNREPTDEEVLLMVLFPLQAKEFLIAREKGELTTL
PPDVVEPKEMKPDGIENVAPVEFEIIYHGDKFKVKIEGVSPEQDPSKPRKFYVNVNGRLE
EVQLTPLAVTLVGKSGFVASAPAAASGSGRPRPEKEGDVAPPMPGKVSKILVNVGDKVKK
GQVVAMVEAMKMENEIHAPIDGVVKEIYAKVGDNITPDETLIRIEPA
NT seq 1944 nt   +upstreamnt  +downstreamnt
atgaatattaaactttttaaagatttacttcaacaaggcaacttagaagttgcaccacca
aaacctattaaaattacagatttaacaccaagagacggccaacaatgtaagttagctaca
agggtaagaacagatgaccttttacctttatgtgaaaagatggataaggctggattctat
gctgtagaggtatggggtggagctacttttgacgtatgcttgagatacctaaaggaagac
ccttgggaaaggctaaaaagaataaaagaagttatgcctcgaacaaagcttcaaatgcta
tttagaggacaaaacattgttggatacaaacctaaatcagacaaagttgttaaaaagttt
gttgaaaaagctatagaacacggtattaccgtatttagagtatttgactcattaaacgat
aacagaaacatagaggttgctgtaaaagctataaaagagtttggcggagaagttcacgca
gaaataagttatacaaaaagccctgtacatactttagaaaagtggatgtcctacgcagat
gagctaatagatttagaaccagactggatatgttttaaagatgctacaggtatacttatg
cctgaggacacatataacataataagaggtataaaacagaaaataaaagaaaaagctaac
gatagaattaaactagtactacataaccacgacatgagtggtacagctataatgaaccat
atgatggctatccttgcaggtgtagatatggtagatacagttctttcaccacttgctttt
ggttcttcccatccggcaaccgaaagtgtagttgcagctcttaaggacacaccttacgat
acaggtttagatttaaaagttttagatgagttagcagaaataacaagagaaattaagaaa
aagtataagaagtatgaaacagagtatgcaggtgtaaacgcaaaagtactaatccataag
ataccgggtggaatgatatctaatatggttgctcagcttatggaagctaatgcattagat
aaaatggaagaagctttagaagaagttccaaatgtagaaagagaccttggatatccacca
cttttaaccccttcatcacaaatagtaggtgtacaagcagttttaaacgtaatatcagga
gagagatacaaaataattacaaaagaagttagagactacgtagaaggaaagtatggtaaa
cctcctggacctatatctaaagagcttgcagaaaagatacttggacctggtaaagaaccg
gacttttctatcagagcaggtgatttagcagacaaggaagagtgggaaaaagcgtacaac
gaagttaagttaatactaaatagagaacctacagacgaagaagtactcttaatggtacta
ttcccattacaagcaaaggagttcttaatagcaagggaaaaaggagagttaacaacactt
ccaccagatgttgtagaaccaaaagaaatgaagccagatggaatagaaaacgtagctcct
gtagagtttgaaataatctaccacggtgataagtttaaagtaaaaatagaaggagtatct
ccagaacaagatccatcaaaaccaagaaagttctatgtaaacgtaaacggaagattagaa
gaagttcaactaacaccactagcagttacattagtaggtaagtctggatttgttgcaagt
gcaccggctgcagcttctgggtctggaagaccaagaccagaaaaagaaggggacgtagct
ccacctatgccaggaaaagtatctaaaatccttgtaaacgttggagataaagttaaaaaa
ggtcaggttgtggcaatggttgaagcaatgaagatggaaaacgaaatacatgctcctata
gatggagtagttaaagaaatatacgcaaaagttggagacaacataactcctgatgaaact
ttaataagaatagaacccgcttaa

DBGET integrated database retrieval system