KEGG   Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA): SaurJH9_0394
Entry
SaurJH9_0394      CDS       T00522                                 
Name
(GenBank) Sec-independent periplasmic protein translocase
  KO
K03118  sec-independent protein translocase protein TatC
Organism
saj  Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA)
Pathway
saj03060  Protein export
saj03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:saj00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    SaurJH9_0394
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SaurJH9_0394
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:saj02044]
    SaurJH9_0394
Secretion system [BR:saj02044]
 Twin-arginine translocation (Tat) system
  Twin-arginine translocation (Tat) pathway protein
   SaurJH9_0394
SSDB
Motif
Pfam: TatC
Other DBs
NCBI-ProteinID: ABQ48200
Position
complement(429758..430363)
AA seq 201 aa
MTPFITYITRAHVSLHAFSFTEMIQIYVMIIFFIAFCFISPVMFYQLWAFIAPGLHNNER
QFIYKYSFFSVLLFCAGVAFAFYVGFPIIIQFALKLSLTLNISPVIGFKAYLVELIRWLF
TFGILFQLPILFIGLAKFGLIDITSLKHYRKYIYFACFVLASIIAPPDLTLNILLTLPLI
LLFEFSMFIVKFTCRGKPPTH
NT seq 606 nt   +upstreamnt  +downstreamnt
atgacaccattcataacgtatattacccgtgcacatgtgtccttacatgcattttcattc
acagaaatgatccaaatatacgtgatgattatatttttcatcgcgttttgtttcatttca
ccagtcatgttttatcaattgtgggcattcattgcacctggattacataataatgaacgt
caatttatttataaatatagttttttcagcgtgttattattctgtgctggcgtcgctttt
gcattttatgttggctttccaataatcattcaattcgcgttaaaattatcattaacttta
aacatttcgcctgtcattggctttaaagcgtatttagttgaacttatccgttggcttttc
acttttggcattttattccaattgccaatattattcataggacttgcaaaattcggtctt
atagatatcacatcattgaagcattatcgaaaatatatttatttcgcttgctttgtgctg
gcaagtatcattgcaccacccgatttaacattaaatatattacttacattgccactcata
ttgctctttgagttcagtatgttcattgttaagttcacatgccgaggcaaaccgccaaca
cattaa

DBGET integrated database retrieval system