KEGG   Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA): SaurJH9_0395
Entry
SaurJH9_0395      CDS       T00522                                 
Name
(GenBank) twin-arginine translocation protein, TatA/E family subunit
  KO
K03116  sec-independent protein translocase protein TatA
Organism
saj  Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA)
Pathway
saj03060  Protein export
saj03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:saj00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    SaurJH9_0395
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SaurJH9_0395
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:saj02044]
    SaurJH9_0395
Secretion system [BR:saj02044]
 Twin-arginine translocation (Tat) system
  Twin-arginine translocation (Tat) pathway protein
   SaurJH9_0395
SSDB
Motif
Pfam: TatA_B_E
Other DBs
NCBI-ProteinID: ABQ48201
Position
complement(430476..430691)
AA seq 71 aa
MITNTFILGITGPTSLVVISIIALIIFGPKKLPQFGRAIGSTLKEFKSATEDLDKESHDT
PSKESKQQREQ
NT seq 216 nt   +upstreamnt  +downstreamnt
atgataactaacacttttattttaggcatcacaggcccaacaagtcttgtcgtcattagc
attatcgctttaattatttttggtccgaaaaaattaccacaatttggtcgtgctatcggt
tctactttaaaagaatttaaatctgcaacagaagatttagacaaagagtctcacgacaca
cccagtaaggaatcgaaacaacagcgagagcaatag

DBGET integrated database retrieval system