KEGG   Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA): SaurJH9_0803
Entry
SaurJH9_0803      CDS       T00522                                 
Name
(GenBank) preprotein translocase, SecG subunit
  KO
K03075  preprotein translocase subunit SecG
Organism
saj  Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA)
Pathway
saj02024  Quorum sensing
saj03060  Protein export
saj03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:saj00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    SaurJH9_0803
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SaurJH9_0803
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SaurJH9_0803
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:saj02044]
    SaurJH9_0803
Secretion system [BR:saj02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   SaurJH9_0803
SSDB
Motif
Pfam: SecG DUF3852
Other DBs
NCBI-ProteinID: ABQ48605
Position
881549..881782
AA seq 77 aa
MHTFLIVLLIIDCIALITVVLLQEGKSSGLSGAISGGAEQLFGKQKQRGVDLFLNRLTII
LSILFFVLMICISYLGM
NT seq 234 nt   +upstreamnt  +downstreamnt
atgcatacatttttaatcgtattattaatcattgattgtattgcattaataactgttgta
ctactccaagaaggtaaaagcagtggactttcaggtgccatcagtggtggtgctgagcag
ttattcggtaaacaaaaacaacgtggcgtcgatttattcttaaatagattaacaattatt
ttatcaatattattttttgtacttatgatttgcataagttatcttggtatgtaa

DBGET integrated database retrieval system