KEGG   Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA): SaurJH9_0964
Entry
SaurJH9_0964      CDS       T00522                                 
Name
(GenBank) signal peptidase I
  KO
K03100  signal peptidase I [EC:3.4.21.89]
Organism
saj  Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA)
Pathway
saj03060  Protein export
Brite
KEGG Orthology (KO) [BR:saj00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    SaurJH9_0964
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:saj01002]
    SaurJH9_0964
Enzymes [BR:saj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.89  signal peptidase I
     SaurJH9_0964
Peptidases and inhibitors [BR:saj01002]
 Serine peptidases
  Family S26: signal peptidase I family
   SaurJH9_0964
SSDB
Motif
Pfam: Peptidase_S26 Peptidase_S24 DUF2534 AsmA Neurensin
Other DBs
NCBI-ProteinID: ABQ48765
Position
1010241..1010765
AA seq 174 aa
MKKVVKYLISLILAIIIVLFVQTFVIVGHVIPNNDMSPTLNKGDRVIVNKIKVTFNQLNN
GDIITYRRGNEIYTSRIIAKPGQSMAFRQGQLYRDDRPVDASYAKNRKIKDFSLRNFKEL
DGDIIPPNNFVVLNDHDNNQHDSRQFGLIDKKDIIGNISLRYYPFSKWTIQFKS
NT seq 525 nt   +upstreamnt  +downstreamnt
gtgaaaaaagttgtaaaatatttgatttcattgatacttgctattatcattgtactgttc
gtacaaacttttgtaatagttggtcatgtcattccgaataatgatatgtcaccaaccctt
aacaaaggggatcgtgttattgtaaataaaattaaagttacatttaatcaattgaataat
ggtgatatcattacatataggcgtggtaacgagatatatactagtcgaattattgccaaa
cctggtcaatcaatggcgtttcgtcagggacaattataccgtgatgaccgaccggttgac
gcatcttatgccaagaacagaaaaattaaagattttagtttgcgcaattttaaagaatta
gatggagatattataccgcctaacaattttgttgtgctaaatgatcatgataacaatcag
catgattctagacaatttggtttaattgataaaaaggatattattggtaatataagtttg
agatattatcctttttcaaaatggacgattcagttcaaatcttaa

KEGG   Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA): SaurJH9_0965
Entry
SaurJH9_0965      CDS       T00522                                 
Name
(GenBank) signal peptidase I
  KO
K03100  signal peptidase I [EC:3.4.21.89]
Organism
saj  Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA)
Pathway
saj03060  Protein export
Brite
KEGG Orthology (KO) [BR:saj00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    SaurJH9_0965
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:saj01002]
    SaurJH9_0965
Enzymes [BR:saj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.89  signal peptidase I
     SaurJH9_0965
Peptidases and inhibitors [BR:saj01002]
 Serine peptidases
  Family S26: signal peptidase I family
   SaurJH9_0965
SSDB
Motif
Pfam: Peptidase_S26 Peptidase_S24
Other DBs
NCBI-ProteinID: ABQ48766
Position
1010781..1011356
AA seq 191 aa
MKKELLEWIISIAVAFVILFIVGKFIVTPYTIKGESMDPTLKDGERVAVNIIGYKTGGLE
KGNVVVFHANKNDDYVKRVIGVPGDKVEYKNDTLYVNGKKQDEPYLNYNLKHKQGDYITG
TFQVKDLPNANPKSNVIPKGKYLVLGDNREVSKDSRAFGLIDEDQIVGKVSFRFWPFSEF
KHNFNPENTKN
NT seq 576 nt   +upstreamnt  +downstreamnt
ttgaaaaaagaattattggaatggattatttcaattgcagtcgcttttgtcattttattt
atagtaggtaaatttattgttacaccatatacaattaaaggtgaatcaatggatccaact
ttgaaagatggcgagcgagtagctgtaaacattattggatataaaacaggtggtttggaa
aaaggtaatgtagttgtcttccatgcaaacaaaaatgatgactatgttaaacgtgtcatc
ggtgttcctggtgataaagtagaatataaaaatgatacattatatgtcaatggtaaaaaa
caagatgaaccatatttaaactataatttaaaacataaacaaggtgattacattactggg
actttccaagttaaagatttaccgaatgcgaatcctaaatcaaatgtcattccaaaaggt
aaatatttagttcttggagataatcgtgaagtaagtaaagatagccgtgcgtttggcctc
attgatgaagaccaaattgttggtaaagtttcatttagattctggccatttagtgaattt
aaacataatttcaatcctgaaaatactaaaaattaa

DBGET integrated database retrieval system