KEGG   Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA): SaurJH9_1255
Entry
SaurJH9_1255      CDS       T00522                                 
Name
(GenBank) lipoprotein signal peptidase
  KO
K03101  signal peptidase II [EC:3.4.23.36]
Organism
saj  Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA)
Pathway
saj03060  Protein export
Brite
KEGG Orthology (KO) [BR:saj00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    SaurJH9_1255
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:saj01002]
    SaurJH9_1255
Enzymes [BR:saj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.36  signal peptidase II
     SaurJH9_1255
Peptidases and inhibitors [BR:saj01002]
 Aspartic peptidases
  Family A8: signal peptidase II family
   SaurJH9_1255
SSDB
Motif
Pfam: Peptidase_A8
Other DBs
NCBI-ProteinID: ABQ49054
UniProt: A5IS81
Position
1300553..1301044
AA seq 163 aa
MHKKYFIGTSILIAVFVVIFDQVTKYIIATTMKIGDSFEVIPHFLNITSHRNNGAAWGIL
SGKMTFFFIITIIILIALVYFFIKDAQYNLFMQVAISLLFAGALGNFIDRILTGEVVDFI
DTNIFGYDFPIFNIADSSLTIGVILIIIALLKDTSNKKEKEVK
NT seq 492 nt   +upstreamnt  +downstreamnt
atgcacaaaaaatattttattggcacttccattttaatagcagtatttgtcgttatattt
gaccaagttactaaatatattatagctactacaatgaaaattggagattcatttgaagtg
ataccgcactttttaaacataacatcacatcgaaataatggtgctgcatggggaatattg
agtggaaaaatgacatttttctttattattaccattattatattaatagccttagtatat
ttctttattaaagatgctcaatataatttgtttatgcaagttgctattagtttacttttt
gcaggtgcacttggaaactttattgatagaattttaacaggagaagttgttgactttatt
gatacaaatatttttggttatgattttccaatatttaatatagcagattcaagtttaaca
attggtgtaatattaattattattgccttattaaaggatacttccaataaaaaggagaag
gaggttaagtaa

DBGET integrated database retrieval system