KEGG   Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA): SaurJH9_1296
Entry
SaurJH9_1296      CDS       T00522                                 
Name
(GenBank) signal recognition particle subunit FFH/SRP54 (srp54)
  KO
K03106  signal recognition particle subunit SRP54 [EC:3.6.5.4]
Organism
saj  Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA)
Pathway
saj02024  Quorum sensing
saj03060  Protein export
saj03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:saj00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    SaurJH9_1296
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SaurJH9_1296
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SaurJH9_1296
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:saj02044]
    SaurJH9_1296
Enzymes [BR:saj01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.4  signal-recognition-particle GTPase
     SaurJH9_1296
Secretion system [BR:saj02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   SaurJH9_1296
  Eukaryotic Sec-SRP protein
   SaurJH9_1296
SSDB
Motif
Pfam: SRP54 SRP_SPB SRP54_N Zeta_toxin AAA_17 AAA_31 AAA_15 AAA_33 CbiA AAA_22 MMR_HSR1 AAA_30 ResIII 6PF2K Tn7_Tnp_TnsA_C ABC_tran
Other DBs
NCBI-ProteinID: ABQ49095
Position
1346884..1348251
AA seq 455 aa
MAFEGLSERLQATMQKMRGKGKLTEADIKIMMREVRLALFEADVNFKVVKEFIKTVSERA
LGSDVMQSLTPGQQVIKIVQDELTKLMGGENTSINMSNKPPTVVMMVGLQGAGKTTTAGK
LALLMRKKYNKKPMLVAADIYRPAAINQLQTVGKQIDIPVYSEGDQVKPQQIVTNALKHA
KEEHLDFVIIDTAGRLHIDEALMNELKEVKEIAKPNEIMLVVDSMTGQDAVNVAESFDDQ
LDVTGVTLTKLDGDTRGGAALSIRSVTQKPIKFVGMSEKLDGLELFHPERMASRILGMGD
VLSLIEKAQQDVDQEKAKDLEKKMRESSFTLDDFLEQLDQVKNLGPLDDIMKMIPGMNKM
KGLDKLNMSEKQIDHIKAIIQSMTPAERNNPDTLNVSRKKRIAKGSGRSLQEVNRLMKQF
NDMKKMMKQFTGGGKGKKGKRNQMQNMLKGMNLPF
NT seq 1368 nt   +upstreamnt  +downstreamnt
atggcatttgaaggcttatcagaacgcctgcaagcgacgatgcaaaaaatgcgtggtaag
ggtaaacttactgaagctgatataaagataatgatgcgtgaagtaagattagcgttattt
gaggctgacgtaaactttaaagtggtaaaagaatttattaaaacagtatcagaacgcgca
ttaggttccgatgtaatgcaatcattaacaccagggcaacaagttattaaaatagttcaa
gatgaattaacgaagttgatgggtggagaaaatacatcgattaatatgtcaaataaacca
cctactgttgttatgatggttggtttacaaggtgctggtaaaacaacaactgcaggtaaa
ttagcattattgatgcgtaaaaaatacaacaaaaaacctatgttagttgcagcagatatt
tatcgtccagcagcgataaatcaattacaaacagtagggaaacaaattgatattcctgta
tacagtgaaggagatcaagtaaagccacaacaaattgtaactaatgcattaaaacatgct
aaagaagaacatttagactttgtaatcattgatacagcaggtcgattacacatcgatgaa
gcattgatgaacgaattaaaagaagtaaaagaaattgctaaaccaaacgaaattatgtta
gttgtcgattcaatgacgggtcaagatgctgtcaatgttgcagaatcttttgacgatcaa
cttgatgtcacaggtgttaccttaactaaattagatggtgatacacgtggtggtgcagct
ttatctattcgttcggtgacacaaaaaccaattaaatttgttggtatgagtgaaaagtta
gatggtttagagctattccatcctgaacgtatggcatcacgtattttaggtatgggtgat
gtgttaagtttaattgaaaaagcgcaacaagatgtggatcaagaaaaagcaaaagattta
gagaaaaagatgcgtgagtcatcgtttactttagatgattttttagaacaacttgatcag
gtgaaaaatctaggaccactggatgatattatgaaaatgattccaggtatgaataaaatg
aaagggctagataagcttaatatgagtgaaaagcaaattgatcatattaaagcgattatc
cagtcaatgacgccggctgaaagaaacaatccagacacattgaatgtatcacgtaaaaag
cgtattgctaaagggtctggtcgttcattacaagaagtcaatcgtttgatgaaacaattt
aacgatatgaagaaaatgatgaaacaattcactggtggcggtaaaggtaaaaaaggtaaa
cgcaatcaaatgcaaaatatgttaaaaggtatgaatttaccgttttaa

DBGET integrated database retrieval system