KEGG   Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA): SaurJH9_1694
Entry
SaurJH9_1694      CDS       T00522                                 
Name
(GenBank) protein translocase subunit secF / protein translocase subunit secD
  KO
K12257  SecD/SecF fusion protein
Organism
saj  Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA)
Pathway
saj02024  Quorum sensing
saj03060  Protein export
saj03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:saj00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    SaurJH9_1694
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SaurJH9_1694
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SaurJH9_1694
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:saj02044]
    SaurJH9_1694
Secretion system [BR:saj02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   SaurJH9_1694
SSDB
Motif
Pfam: SecD_SecF Sec_GG MMPL POTRA
Other DBs
NCBI-ProteinID: ABQ49484
Position
complement(1796051..1798330)
AA seq 759 aa
MKKSSRIIAFLLLVVLLFAGMAATYKSVIKNVNLGLDLQGGFEVLYQVDPLNKGDKIDKK
ALQSTAQTLENRVNVLGVSEPKIQVEEPNRIRVQLAGVTDQNEARKILSSQANLTIRDAE
DKVKLSGSDIKQGSAKQEFKQETNQPTVTFKVKDKNKFKKVTEEISKKRDNVMVVWLDFK
KGDSYKKEAQKKNPKFISAASVDQPINSDSVEISGGFKGQEGVKKAKQIAELLNAGSLPV
DLKEIYSNSVGAQFGQDALDKTVFASFIGVALIYLFMLGFYRLPGLVAIIALTTYIYLTL
VAFNFISGVLTLPGLAALVLGVGMAVDANIIMYERIKDELRIGRTIKQAFSKANKSSFLT
IFDSNLTTVIAAAVLFFFGESSVKGFATMLLLGILMIFVTAVFLSRFLLSLLVSSNIFKN
QFWLFGVKKNKRHDINEGVDVHDLKTSFEKWNFVKLAKPLIGVSILIVVVGLVILYIFKL
NLGIDFSSGTRVDFQSKQAITQQKVEQVVKDSGLKADQIQINGKDNKVATVQFKDDLTRA
QDNKLSDNIKSKFGDTPQINTVSPIIGQELAKNAMLALIYASIGIIIYVSLRFEWRMGLS
SVLALLHDVFIIVAIFSLFRIEVDLTFIAAVLTIVGYSINDTIVTFDRVRENLQKVKVIT
TTEQIDDIVNRSIRQTMTRSINTVLTVIVVVVAILFFGAPTIFNFTLALFIGLISGVFSS
IFIAVPLWGIMKKRQLKKSPKHKLVVYKEKKSNDEKILV
NT seq 2280 nt   +upstreamnt  +downstreamnt
gtgaagaaaagtagtagaataattgcgttcttgcttttagtcgtattgttgtttgccgga
atggctgcaacttataaaagtgttataaagaatgtcaatttaggacttgatttgcaaggt
ggatttgaggtgctttatcaagtcgatcctttaaataaaggcgacaaaatagataaaaaa
gccttacaatcaacagcgcaaacattagaaaatcgtgttaacgttttaggtgtttcggaa
cctaaaattcaagttgaagaacctaatagaattagagttcaacttgctggtgtaacagac
cagaatgaagcacgtaaaattttatcttctcaagctaatttaacaattcgcgatgcagaa
gataaagtaaaattaagcggttctgatattaaacagggatctgccaaacaagaatttaaa
caggaaacaaaccagcctacagttacttttaaagtaaaagacaaaaacaaatttaaaaaa
gtaacggaagaaatctctaagaaacgtgataatgtcatggttgtttggttagatttcaaa
aaaggtgacagctataaaaaagaagcacaaaagaaaaaccctaaatttatttctgcagca
agtgttgatcaaccaatcaattctgatagcgtagaaatctcgggtggatttaaaggacaa
gaaggcgttaaaaaagcaaaacaaatcgccgaattgttaaatgcaggttctttaccagtt
gacttgaaagaaatttattcaaactcagtaggtgcccaatttggtcaagatgcattagat
aaaactgtgtttgcatcgtttattggtgtagcattaatttatttattcatgcttggattc
taccgattacctggtttagtagcgattattgcattgacaacttatatctatctaacgtta
gtagcatttaatttcatttccggggttctaactttaccaggattagcggcgttggtatta
ggtgtaggtatggctgtagatgccaatattatcatgtatgagcgtattaaggatgaactt
cgaataggtagaacgataaagcaagccttttctaaagcaaacaaaagttcattcctaaca
atttttgattctaacttaacaacagttatcgccgcagcagtattattcttcttcggtgaa
agttcagttaaaggtttcgcgacaatgttattattaggtattctaatgatctttgttaca
gccgtgttcttatcaagattcttattatcattacttgtttcatcaaatatattcaaaaat
caattttggttatttggtgttaaaaagaataaacgacatgatattaatgaaggtgtagat
gttcatgaccttaaaacttcattcgagaaatggaattttgttaaattagctaagccatta
attggagtaagtattttaattgtagttgtcggtttagttattctttatatcttcaagtta
aacttaggaattgatttctcaagtggtacacgtgtagatttccaatctaaacaagcaatt
actcaacaaaaggttgagcaagttgtaaaagatagtggacttaaagcggatcaaattcaa
atcaatggtaaagataataaagtagcaactgttcaatttaaagacgatttaacgcgtgct
caagataataaattgagtgataatattaaatcgaaattcggtgacacacctcaaattaat
actgtatcaccaattattggacaggaattagcaaaaaatgcaatgcttgcattaatctat
gcatcgataggtatcatcatctatgtatcattacgatttgaatggcgcatgggtctttca
tctgtattggcattattacatgatgtattcattatagtagcgattttcagtttatttaga
attgaagtagatttaacatttatcgccgctgtattaacaattgtcggttattcaattaat
gatacaatcgtaacgtttgaccgtgtacgtgaaaacttacaaaaggttaaagtgattacg
acaacagaacaaattgatgatatcgttaatagatcaattagacagacaatgacacgttca
attaatacagtattaacagttattgtagtagtagttgctatactattcttcggtgctcct
acgatattcaactttactttagcattatttatcggattgatttctggtgtattctcttca
atcttcattgccgttccgctatggggaataatgaaaaaacgtcagttgaaaaaatcgccg
aaacacaaattagttgtatataaagaaaagaaatcgaacgatgaaaagattttagtttaa

DBGET integrated database retrieval system