KEGG   Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA): SaurJH9_2127
Entry
SaurJH9_2127      CDS       T00522                                 
Name
(GenBank) 60 kDa inner membrane insertion protein
  KO
K03217  YidC/Oxa1 family membrane protein insertase
Organism
saj  Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA)
Pathway
saj02024  Quorum sensing
saj03060  Protein export
saj03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:saj00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    SaurJH9_2127
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SaurJH9_2127
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SaurJH9_2127
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:saj03029]
    SaurJH9_2127
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:saj02044]
    SaurJH9_2127
Mitochondrial biogenesis [BR:saj03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    SaurJH9_2127
Secretion system [BR:saj02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   SaurJH9_2127
SSDB
Motif
Pfam: 60KD_IMP DUF4181 Succ_DH_flav_C SurA_N_2 DUF6377
Other DBs
NCBI-ProteinID: ABQ49909
UniProt: A5IUN6
Position
complement(2252530..2253402)
AA seq 290 aa
MKKKALLPLFLGIMVFLAGCDYSKPEKRSGFFYNTFVDPMKNVLDWLGNNLLNDNYGLAI
IILVLVIRIILLPFMLSNYKNSHMMRQKMKVAKPEVEKIQEKVKRARTQEEKMAANQELM
QVYKKYDMNPIKSMLGCLPMLIQLPIIMGLYFVLKDQLVDGLFKYPHFLWFDLGRPDIWI
TIIAGVLYFIQAYVSSKTMPDEQRQMGYMMMVISPIMIIWISLSSASALGLYWSVSAAFL
VVQTHFANIYYEKVAKKEVQPFIEAYEREHNGGSNKKGKNTQVVSKKKKK
NT seq 873 nt   +upstreamnt  +downstreamnt
atgaagaaaaaagcgttactaccattatttttaggtattatggtctttttggctggttgt
gactattctaaacctgaaaaacgtagtgggtttttctacaatacattcgtagatccaatg
aaaaatgtattggattggttgggaaataacttattaaacgacaattatggtttagctatt
attatccttgtattggtaattcgtattattttattaccattcatgttgtcaaactataaa
aatagtcatatgatgcgtcaaaaaatgaaagttgcaaagccagaagttgaaaaaattcaa
gaaaaagtgaaacgtgcgcgtacacaagaagaaaaaatggctgcaaaccaagaattaatg
caagtatataaaaagtatgacatgaacccgattaagagtatgttgggttgtttaccaatg
ctaatccaattgccaatcatcatgggattatactttgtacttaaagaccaacttgtagat
ggtttgtttaaatatccacacttcttatggttcgatttaggacgtcctgatatttggatt
acaattattgccggtgttttatactttatccaagcatatgtatcaagtaaaacgatgcca
gacgaacaacggcaaatgggttacatgatgatggtcatttcaccaattatgattatctgg
atttcattaagctcagcatcagcacttggtttgtactggtctgtcagtgcggcattcctt
gtagttcaaacacactttgcgaacatttattatgaaaaagtcgctaaaaaagaagtacaa
cctttcattgaagcgtatgaaagagagcacaacggcggcagcaataaaaaaggcaaaaac
acacaagtagtgtctaaaaagaaaaagaaataa

DBGET integrated database retrieval system