KEGG   Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA): SaurJH9_2257
Entry
SaurJH9_2257      CDS       T00522                                 
Name
(GenBank) protein translocase subunit secY/sec61 alpha
  KO
K03076  preprotein translocase subunit SecY
Organism
saj  Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA)
Pathway
saj02024  Quorum sensing
saj03060  Protein export
saj03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:saj00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    SaurJH9_2257
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SaurJH9_2257
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SaurJH9_2257
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:saj02044]
    SaurJH9_2257
Secretion system [BR:saj02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   SaurJH9_2257
SSDB
Motif
Pfam: SecY
Other DBs
NCBI-ProteinID: ABQ50037
Position
complement(2397946..2399238)
AA seq 430 aa
MIQTLVNFFRTKEVRNKIFFTLAMLVIFKIGTYIPAPGVNPAAFDNPQGSQGATELLNTF
GGGALKRFSIFAMGIVPYITASIVMQLLQMDIVPKFSEWAKQGEVGRRKLNNVTRYLAIS
LAFIQSIGMAFQFNNYLKGALIINQSIMSYLLIALVLTAGTAFLIWLGDQITQFGVGNGI
SIIIFAGILSTLPASLIQFGQTAFVGQEDTSLAWLKVLGLLVSLILLTVGAIYVLEAVRK
IPIQYAKKQTAQRLGSQATYLPLKVNSAGVIPVIFAMAFFLLPRTLTLFYPDKEWAQNIA
NAANPSSNVGMVVYIVLIILFTYFYAFVQVNPEKMADNLKKQGSYVPGIRPGEQTKKYIT
KVLYRLTFVGSIFLAVISILPILATKFMGLPQSIQIGGTSLLIVIGVAIETMKSLEAQVS
QKEYKGFGGR
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgattcaaacccttgtgaacttctttagaacaaaagaggttcgtaacaagattttcttc
acactagcaatgttagtaatttttaaaatagggacttatataccagctccaggagtaaat
cctgcagcttttgataatccccaaggttctcaaggtgccactgagttattaaatactttt
ggtggcggagccttgaaacgattttctatttttgcaatgggtattgtaccctacatcact
gcatcaatcgtaatgcaattattacaaatggatattgtccctaaattctcagaatgggca
aaacaaggtgaagtaggtagaagaaagttaaataacgttactcgttatttagcaatttct
ttagcatttatccaatctataggtatggcattccaatttaataattatctcaaaggtgcg
ctgattatcaatcagtcaattatgagttatttattaatagcactagttttgacagcagga
actgctttcttaatatggcttggtgatcaaatcactcagttcggtgttggtaatggtatt
tctattatcatatttgcgggtattttatcaacgttgccagccagtctaattcaatttgga
caaactgcgttcgttgggcaagaagatacatcattagcatggttgaaagtattaggactt
ttagtgtcactgatactattaactgtaggtgctatttatgtacttgaagccgttcgtaaa
attccgattcaatatgctaagaaacaaactgctcaaagattaggttcacaggcaacttat
ctacctttaaaagtgaactcagccggtgttattcctgtaatctttgcaatggcgttcttc
ttactgcctagaacattaacgttgttctatccagataaagaatgggcacaaaacattgcg
aatgctgcaaatccttcaagtaatgttggtatggttgtatatattgtactaattatacta
ttcacatacttctatgcatttgtacaagttaatccggaaaaaatggctgataaccttaag
aaacaaggtagctatgttccaggcattagacctggtgaacaaaccaaaaaatatattact
aaagttttatatcgtttaacttttgtaggttctatcttcttagccgttatttcaattcta
ccaatattagcaactaagtttatgggattaccacaatcaattcagattggtggtacaagt
ttacttatcgttattggtgtagcgattgaaacaatgaaatctttagaagctcaagtatct
caaaaagaatataaaggctttggtggtagataa

KEGG   Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA): SaurJH9_2677
Entry
SaurJH9_2677      CDS       T00522                                 
Name
(GenBank) SecY-related translocase
  KO
K03076  preprotein translocase subunit SecY
Organism
saj  Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA)
Pathway
saj02024  Quorum sensing
saj03060  Protein export
saj03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:saj00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    SaurJH9_2677
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SaurJH9_2677
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SaurJH9_2677
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:saj02044]
    SaurJH9_2677
Secretion system [BR:saj02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   SaurJH9_2677
SSDB
Motif
Pfam: SecY
Other DBs
NCBI-ProteinID: ABQ50453
Position
complement(2845853..2847064)
AA seq 403 aa
MLKLLQQYEYKIIYKRMLYTCFILFIYILGTNISIVSYNDMQVKHESFFKIAISNMGGDV
NTLNIFTLGLVPWLTSMIILMLISYRNMDKYMKQTSLEKHYKERILTLILSVIQSYFVIH
EYVSKERVHQDNIYLTILILVTGTMLLVWLADKNSRYGIAGPMPIVMVSIIKSMMHQKME
YIDASHIVIALLIILVIITLFILLFIELVEVRIPYIDLMNVSATNMKSYLSWKVNPAGSI
TLMMSISAFVFLKSGIHFILSMFNKSISDDMPMLTFDSPVGISVYLVIQMLLGYFLSRFL
INTKQKSKDFLKSGNYFSGVKPGKDTERYLNYQARRVCWFGSALVTVIIGIPLYFTLFVP
HLSTEIYFSVQLIVLVYISINIAETIRTYLYFDKYKPFLNQYW
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgttaaaacttttacaacaatacgaatataaaattatatataaacgtatgctatacaca
tgttttatattatttatttatatattaggtacaaacatttccatcgtttcctataacgat
atgcaagtaaaacatgagtcattttttaaaatagctatttctaatatgggtggagacgtt
aatactttaaacattttcactttaggattagttccgtggttaacatcaatgattatcttg
atgctgatttcttatcggaatatggataaatacatgaaacaaacaagtcttgagaagcat
tataaagagcgtatcttaacattaattttaagtgtgattcaaagttattttgtgattcat
gaatatgtttcgaaagaacgtgttcatcaagacaatatttacttaacaatattgattttg
gttactggaacgatgttattagtttggttagctgacaaaaatagtcgttacggcatcgca
ggaccaatgccgattgtaatggttagcattattaaatcaatgatgcatcaaaaaatggaa
tatatagatgcaagtcatattgtgattgcgttgttaatcatccttgtgataatcacattg
tttatcttattattcattgaattagtagaagtgagaataccatatatcgatttaatgaac
gtttccgcaacaaatatgaaatcttatttatcttggaaagttaaccctgcaggcagtatt
actttaatgatgagtatttcagcatttgttttcttgaaaagtggcattcattttatttta
tctatgtttaataaaagcatatcagatgacatgccaatgctgacatttgatagtccagta
ggtatttcagtatatttagtgattcaaatgttattgggttattttttatcgagattttta
atcaatactaaacaaaaatccaaagatttcttaaagagtggcaattatttttcaggagtt
aaacctggtaaggatacagaacgttatttaaattatcaagcaagacgcgtatgttggttt
ggatcggcattagttacagtcattattggtataccgctttatttcacattgtttgtaccg
catttatctactgaaatttatttctcagtacaactgattgtattagtttacatcagtatt
aatattgcagaaacaattcgtacatatttatattttgataaatataagccatttttaaac
cagtattggtaa

DBGET integrated database retrieval system