Streptomyces noursei ZPM: SAZ_21580 Help Entry SAZ_21580         CDS       T03896                                  Name (GenBank) NUDIX hydrolase   KO K03574   8-oxo-dGTP diphosphatase [EC:3.6.1.55] Organism sall  Streptomyces noursei ZPM Brite KEGG Orthology (KO) [BR:sall00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:sall03400]     SAZ_21580 Enzymes [BR:sall01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.55  8-oxo-dGTP diphosphatase      SAZ_21580 DNA repair and recombination proteins [BR:sall03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     SAZ_21580  Prokaryotic type     SAZ_21580 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NUDIX NUDIX_4 Motif Other DBs NCBI-ProteinID:  AKA04759 Position complement(4925095..4925508) Genome browser AA seq 137 aa AA seqDB search MTQQTADERPGIAAAIIVHEGRVLMVRRRISEGKLSWQFPAGEVEPGETREDAAVRETKE ETGLNVSAVELLGERVHPATSRLMSYTACEVLSGTAHVADTEELAELAWVAHDQIADYVP YGLFGPVQEYLDATLAS NT seq 414 nt NT seq  +upstreamnt  +downstreamnt gtgacgcagcagacagccgatgagcgacccggcattgcggcggccatcatcgttcacgag ggacgcgttctgatggtccggcgccggatcagcgaagggaagctctcctggcagttcccg gccggcgaagtcgagcccggcgaaacccgcgaggacgccgccgtgcgggagaccaaggag gagaccggactgaacgtctccgccgtcgagctgctgggcgagcgtgtccacccggccacg agccggctgatgtcctacaccgcctgcgaagtgctcagcggaaccgcgcatgttgcggac accgaggaactggccgagcttgcctgggtggctcacgaccagatcgccgactacgtcccg tacggcttgttcgggccggtgcaggagtacctggacgccacgctcgccagctag

All links   Gene (2) NCBI-PROTEINID (1) OC (1) Protein domain (2) Pfam (2) All databases (4) Download RDF

DBGET integrated database retrieval system