Silicimonas algicola: EF888_21020 Help Entry EF888_21020       CDS       T05779                                  Symbol mutT Name (GenBank) 8-oxo-dGTP diphosphatase MutT   KO K03574   8-oxo-dGTP diphosphatase [EC:3.6.1.55] Organism salo  Silicimonas algicola Brite KEGG Orthology (KO) [BR:salo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:salo03400]     EF888_21020 (mutT) Enzymes [BR:salo01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.55  8-oxo-dGTP diphosphatase      EF888_21020 (mutT) DNA repair and recombination proteins [BR:salo03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     EF888_21020 (mutT)  Prokaryotic type     EF888_21020 (mutT) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NUDIX_4 NUDIX Nudt16-like DUF6480 NUDIX_2 Motif Other DBs NCBI-ProteinID:  AZQ69408 UniProt:  A0A316G767 Position 4237930..4238328 Genome browser AA seq 132 aa AA seqDB search MKTVLVSAVALIDPDGRILLAQRPEGKSLAGLWEFPGGKVEPGETPEAALIRELHEEIGI ETWQSCLAPLTFASHSYDDFHLLMPLFACRKWQGTPTAREGQVLKWVRPTALRDYPMPPA DLPLIPILRDWL NT seq 399 nt NT seq  +upstreamnt  +downstreamnt gtgaagacagtccttgtttcggccgttgcgctgatcgatcccgacgggcggattttgctg gcgcaacgcccggaagggaaaagcctggctggtctgtgggagttcccgggcggaaaggtc gaacccggcgaaacgcccgaggcagccttgatccgcgagcttcacgaggagatcgggatt gaaacctggcaaagctgcctcgcccccctgaccttcgcaagccacagctatgacgacttt cacctgctgatgccgctgttcgcatgccgcaaatggcagggcacacctacggcgcgcgag ggccaggtgctgaaatgggttcggccgacagcacttcgcgactatcccatgccgcccgcc gatctgcctctgatcccgatcctgcgcgactggctctaa

All links   Gene (1) NCBI-PROTEINID (1) Protein sequence (1) UniProt (1) Protein domain (5) Pfam (5) All databases (7) Download RDF

DBGET integrated database retrieval system