KEGG   Streptomyces ambofaciens: SAM23877_5623
Entry
SAM23877_5623     CDS       T04055                                 
Symbol
srm14
Name
(GenBank) putative NDP-hexose isomerase
  KO
K19853  TDP-4-oxo-6-deoxy-alpha-D-glucose-3,4-oxoisomerase [EC:5.3.2.4]
Organism
samb  Streptomyces ambofaciens
Pathway
samb00523  Polyketide sugar unit biosynthesis
samb01100  Metabolic pathways
samb01110  Biosynthesis of secondary metabolites
samb01250  Biosynthesis of nucleotide sugars
Module
samb_M00796  dTDP-D-mycaminose biosynthesis
Brite
KEGG Orthology (KO) [BR:samb00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SAM23877_5623 (srm14)
Enzymes [BR:samb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.2  Interconverting keto- and enol-groups
    5.3.2.4  TDP-4-oxo-6-deoxy-alpha-D-glucose-3,4-oxoisomerase (dTDP-3-dehydro-6-deoxy-alpha-D-glucopyranose-forming)
     SAM23877_5623 (srm14)
SSDB
Motif
Pfam: FdtA PqqD
Other DBs
NCBI-ProteinID: AKZ58668
UniProt: A0A0K2B0C6
Position
complement(6007365..6007715)
AA seq 116 aa
MIESGVTVDFPVRRVYYMHGQTQSSPPRGLHAHRTLEQLVIAVHGAFSITLDDGFQHATY
RLDEPGAGLCIGPMVWRVLKDFDPDTVALVLASQHYEESDYYRDYDTFLHDARSLT
NT seq 351 nt   +upstreamnt  +downstreamnt
gtgatcgagtccggcgtgaccgtggacttccccgtccgacgcgtctactacatgcatggc
cagacccagtcctctcccccgcgcggcctgcacgcgcaccgcaccctggaacaactcgtc
atcgccgtccacggcgccttctccatcaccctcgacgacggcttccagcacgccacctac
cgtctggacgaacccggagccggactctgcatcggccccatggtctggcgcgtcctgaag
gacttcgaccccgacaccgtggccctggtcctcgcctcgcagcactacgaggagtccgac
tactaccgcgactacgacaccttcctgcatgacgcacggagcctcacatga

DBGET integrated database retrieval system