KEGG   Sandaracinobacter sp. M6: H3309_09115
Entry
H3309_09115       CDS       T06739                                 

Definition
(GenBank) 2-hydroxychromene-2-carboxylate isomerase
  KO
K14584  2-hydroxychromene-2-carboxylate isomerase [EC:5.99.1.4]
Organism
sand  Sandaracinobacter sp. M6
Pathway
sand00626  Naphthalene degradation
sand01100  Metabolic pathways
sand01120  Microbial metabolism in diverse environments
sand01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sand00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    H3309_09115
Enzymes [BR:sand01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.4  2-hydroxychromene-2-carboxylate isomerase
     H3309_09115
SSDB
Motif
Pfam: DSBA Thioredoxin_4
Other DBs
NCBI-ProteinID: QMW21583
UniProt: A0A7G5IDZ1
Position
1821374..1821967
AA seq 197 aa
MKQRIELFFDFRSPYSYLAFTQLLQIEAALVLRPMQVLKVMAQVGNTPTTLLCKPKGAYA
NIDLARWASRYGIALNPSDMMRNDGDGCARAVLAVGSPEDAVAVATILYRAIWSEGVALT
GTQEIIAALSAAGLETDTIAARIDSQAVAALLAANSDEAAQRGVFGSPTMFVGDQMFFGN
DRLDFLRAALLSSARAA
NT seq 594 nt   +upstreamnt  +downstreamnt
atgaagcagcgcatcgaattgttcttcgatttccgcagcccctacagctacctcgccttc
acccagctccttcagatcgaagctgcactggtgctgcggccgatgcaggtgctcaaggtc
atggcgcaggtcggcaacacgcccaccacgctgctgtgcaagcccaagggcgcctatgcc
aacatcgaccttgcgcgctgggcgagccgctacggaatcgcgctcaacccttccgacatg
atgcgcaacgacggcgacgggtgcgctcgcgccgtgctcgcggtaggctcgcccgaagac
gcggttgctgtcgccaccatcctctaccgcgccatctggagcgagggggtggcgctgacg
ggcacacaggagattattgccgccttgtccgccgccgggctcgagacggacaccatcgcc
gcgcggatcgacagccaggctgtcgccgcgttgctggccgccaactctgacgaggcggcg
cagcgcggggtgtttggttcgccaacgatgttcgtgggagaccagatgttcttcggcaac
gaccggctggacttcctgcgcgcagcgctcttgtcgtcggcgcgcgcagcatga

DBGET integrated database retrieval system