KEGG   Salinispora arenicola: Sare_1271
Entry
Sare_1271         CDS       T00613                                 

Name
(GenBank) Methyltransferase type 11
  KO
K15467  27-O-demethylrifamycin SV methyltransferase [EC:2.1.1.315]
Organism
saq  Salinispora arenicola
Pathway
saq01051  Biosynthesis of ansamycins
saq01052  Type I polyketide structures
saq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:saq00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01052 Type I polyketide structures
    Sare_1271
   01051 Biosynthesis of ansamycins
    Sare_1271
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:saq01008]
    Sare_1271
Enzymes [BR:saq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.315  27-O-demethylrifamycin SV methyltransferase
     Sare_1271
Polyketide biosynthesis proteins [BR:saq01008]
 Polyketide tailoring proteins
  Methylase
   Sare_1271
SSDB
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_31 Methyltransf_23 Methyltransf_12 Ubie_methyltran CMAS MetW Methyltransf_9 Methyltransf_29 PCMT UPF0020 MTS CheR Methyltransf_32 PrmA Methyltransf_4 ADH_zinc_N Methyltransf_18 DREV Methyltransf_8 Pox_MCEL GidB DOT1 NAS
Other DBs
NCBI-ProteinID: ABV97176
UniProt: A8M6Z4
Position
1473050..1473874
AA seq 274 aa
MKKPTPNEIGQGYDAFADLLDQLWGVNLHHGYWEDASENVSVTGAANRLTDKLADLLTIE
AGDRVLDLGCGIGEPAIRLATAHTIEVVGISISGRQVERAQERAVSAGLADRLSFELADA
MDLPYPEESFDIVWALESLHHMPDRAHVLRQMTRVLRPGGRVAIGDFMLLPSAGGYEAGA
ARVNEASKGVLSVIGLDAYLAMIRAAGLVPVATEDVSKHTRPSWAKAEERFAALREQAVP
HIGKEQFDLTLARFRAFSQEPALGYALLTAHKPA
NT seq 825 nt   +upstreamnt  +downstreamnt
gtgaagaagccgacgccgaatgagattggccagggttacgacgcgttcgcggatctactc
gaccagctctggggtgtgaatctgcaccatggctactgggaggacgcgtccgaaaatgtg
tcggtgacgggggccgccaatcgtctgactgacaaactcgccgatctgctgaccatcgag
gccggcgatcgtgtgctcgatctcggttgcggtatcggcgagccggccatcaggctggcc
acggcccacacgattgaagtcgtgggcatctcgatcagtggtcgccaggtggagcgggca
caggagagggcggtgtccgccggtctggccgaccggttgtccttcgagctggccgatgcg
atggacctgccgtatccggaggaatcattcgatatcgtatgggcgctggagtccctgcat
cacatgcccgatcgggcccatgtgctccgacaaatgacccgggtgctgcggcccggcggc
cgggtggcgatcggtgacttcatgctcctgccgagtgccggcggctacgaggcaggagcc
gcccgggtcaacgaggcgagcaagggtgtcctgtcggtcatcggccttgacgcctacctg
gccatgatccgtgcggccgggctcgttccggtggcgaccgaagacgtcagcaagcacacc
cggccatcctgggccaaggccgaagagcggttcgccgccctccgggagcaggccgtaccg
cacatcggaaaagagcagttcgatctcacgctcgccagattccgcgcattcagccaggag
ccggcgttggggtacgccctcctgaccgcccacaagcctgcctga

DBGET integrated database retrieval system