Streptomyces aquilus: EJC51_44455 Help Entry EJC51_44455       CDS       T07011                                  Name (GenBank) NUDIX hydrolase   KO K03574   8-oxo-dGTP diphosphatase [EC:3.6.1.55] Organism saqu  Streptomyces aquilus Brite KEGG Orthology (KO) [BR:saqu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:saqu03400]     EJC51_44455 Enzymes [BR:saqu01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.55  8-oxo-dGTP diphosphatase      EJC51_44455 DNA repair and recombination proteins [BR:saqu03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     EJC51_44455  Prokaryotic type     EJC51_44455 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NUDIX Motif Other DBs NCBI-ProteinID:  AZP22515 UniProt:  A0A3S9IDU8 Position 9719944..9720324 Genome browser AA seq 126 aa AA seqDB search MTMEQTTEDVVDAVVLYDGRVLLVNAQDRWTLPSGDPEPAESASATAARVVYELTGYLVD GSTPLPQRGADAAGGRRAVVCQLLSETPSGNARLAAEQVRWSSLAEAVDAGLSETVRVYL EGHTPV NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgacgatggagcagacgaccgaggacgtggtggacgcggtcgtgctctacgacggccgg gtgttgctggtgaacgcgcaggaccgctggaccttgccctcgggcgaccccgaacccgcc gaatcggcgtcggccaccgcggcgcgcgtggtgtacgagctcaccggctacctcgtcgac ggttcgacgcccctgccgcagcggggagcggatgcggcaggcgggcggagggccgtggtg tgccaactgctgagcgagaccccgtcgggtaacgcgcggctcgcggcggagcaggtccgc tggtcctcgctcgcggaagcggtcgatgccgggctttccgagacggtgcgggtctatttg gagggccacacacccgtgtaa

All links   Gene (1) NCBI-PROTEINID (1) Protein sequence (1) UniProt (1) Protein domain (1) Pfam (1) All databases (3) Download RDF

DBGET integrated database retrieval system