KEGG   Streptomyces auratus: SU9_021755
Entry
SU9_021755        CDS       T07630                                 

Name
(GenBank) sugar kinase
  KO
K21056  alpha-D-ribose-1-phosphate 5-kinase (ADP) [EC:2.7.1.212]
Organism
sauh  Streptomyces auratus
Brite
KEGG Orthology (KO) [BR:sauh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SU9_021755
Enzymes [BR:sauh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.212  alpha-D-ribose-1-phosphate 5-kinase (ADP)
     SU9_021755
SSDB
Motif
Pfam: PfkB
Other DBs
NCBI-ProteinID: QTZ93751
UniProt: A0A8B1P6R1
Position
complement(4981223..4982116)
AA seq 297 aa
MLEGDRRPAPGASRGPRRVLVAGGTNFDIIVRADRLPEEHEKLRGGECAASPGGSAANTA
LGLARQGCAVRLVSAVGDDALGRVCLDDLRAGGVDTSLTRVDPATRTGMAIVLSAGAGKR
MMTFAGADRDAAIGAVTEDDIRAVDHVHVVGEPTPPLVRLVQLAHRSGRPVSVEWNGRDM
SALAGEATLHLMNADEARRLPGAPGNDAAAAARHYADALPGEVIVTLGPEGALWASPGRR
TLHVPTTPVAPVDRTGGGDAFNAGVLAGWLSGESPETCLRRGLDAALHVITKIGAHP
NT seq 894 nt   +upstreamnt  +downstreamnt
gtgctagagggcgaccggcgccccgcgcccggagcgtcccgggggccgcggcgggtgctc
gtcgccggcggtaccaacttcgacatcatcgtccgggccgaccgcctgcccgaggagcac
gagaagctgcggggcggcgagtgcgccgcgtcgccgggaggatcggcggccaacaccgcc
ctgggcctcgcccggcagggctgcgcggtccggctggtgtccgccgtgggcgacgacgcc
ctgggccgagtgtgcctcgacgacctgcgcgccgggggtgtggacacctcgctgacccgg
gtggacccggccacccggaccggtatggcgatcgtcctgtccgccggcgcgggcaaaaga
atgatgacgttcgccggagcggaccgggacgccgcgatcggcgcggtcaccgaggacgac
atccgcgccgtggaccacgtccacgtcgtcggcgaacccacaccgcccctcgtccggttg
gtgcagctcgcccaccggtccggccgtccggtatcggtcgaatggaacggcagggacatg
agcgccctcgccggcgaggcgaccctgcatctgatgaacgcggacgaggcccgccggctg
ccgggggcgccgggcaacgacgcggcggccgcggcccggcactacgccgacgcgctgccg
ggtgaggtgatcgtgaccctgggcccggagggggcgctgtgggcctcacccggccgtcgg
acgctgcacgtacccaccactccggtggcgccggtggaccggaccggcggcggcgatgcc
ttcaacgccggtgtcctcgcagggtggttgagcggagaatcgccggaaacctgtctgcgc
cggggcctcgacgcagcattacacgtgatcacgaagataggagctcatccgtga

DBGET integrated database retrieval system