KEGG   Sphingobium barthaii: H5V43_22255
Entry
H5V43_22255       CDS       T06985                                 

Definition
(GenBank) 2-hydroxychromene-2-carboxylate isomerase
  KO
K14584  2-hydroxychromene-2-carboxylate isomerase [EC:5.99.1.4]
Organism
sbar  Sphingobium barthaii
Pathway
sbar00626  Naphthalene degradation
sbar01100  Metabolic pathways
sbar01120  Microbial metabolism in diverse environments
sbar01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sbar00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    H5V43_22255
Enzymes [BR:sbar01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.4  2-hydroxychromene-2-carboxylate isomerase
     H5V43_22255
SSDB
Motif
Pfam: DSBA NAD_binding_11
Other DBs
NCBI-ProteinID: QOT74581
Position
p1:complement(182082..182675)
AA seq 197 aa
MSRKIDFYFDFISPFSYLAQLKLPEIARKAGCELEYWPIDIPEAKIAAGNYGPSNREVVP
KIKVMMADLNRWAHKYDAPLRFPASFACKDWNCATLYAREQGKAEAYVAAAYNLIWGQGI
DPSDRGELRACATEAGLDPEALTAFVDSSLGQNEYRKARSLAYQRGVFGAPLMFVDDQIF
WGNDRLDFLQEYLSQQK
NT seq 594 nt   +upstreamnt  +downstreamnt
atgagccgcaagatcgacttctatttcgacttcatcagtcccttcagttacctcgcgcag
ctgaagctcccggaaatagcccgcaaggccggttgcgaactcgaatattggccgatcgat
atccccgaggcgaagatcgcggcggggaactacggcccgtccaatcgcgaggtggttccg
aaaatcaaggtgatgatggcggacctcaaccggtgggcccacaaatatgacgctcccttg
cgttttccggccagctttgcctgcaaggactggaactgcgccacgctctacgcgcgcgag
cagggcaaagcggaagcatacgtcgctgccgcttacaatctgatctggggacagggaatc
gacccaagcgaccgcggagaactgcgcgcctgtgcaacagaagctggactcgatccagag
gcgttgacagccttcgtggactcttcacttggccagaatgaatatcgcaaggctcgcagc
ctagcctatcagcggggagtcttcggcgcgccgttaatgtttgtcgacgatcaaatattc
tggggcaatgatcgtctcgactttctgcaggagtatctatctcaacagaagtaa

DBGET integrated database retrieval system