KEGG   Sorghum bicolor (sorghum): 8056944
Entry
8056944           CDS       T01086                                 

Name
(RefSeq) 3,9-dihydroxypterocarpan 6A-monooxygenase
  KO
K23180  flavone synthase II [EC:1.14.19.76]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi00941  Flavonoid biosynthesis
sbi01100  Metabolic pathways
sbi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    8056944
   00943 Isoflavonoid biosynthesis
    8056944
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:sbi00199]
    8056944
Enzymes [BR:sbi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.76  flavone synthase II
     8056944
Cytochrome P450 [BR:sbi00199]
 Cytochrome P450, plant type
  CYP93 family
   8056944
SSDB
Motif
Pfam: p450 GCIP
Other DBs
NCBI-GeneID: 8056944
NCBI-ProteinID: XP_002447397
UniProt: C5YB78
Position
6:complement(106853..108971)
AA seq 555 aa
MAAMEEQPLSSSSTSMAIVLSLLKNNPADAVLLALVAVVALRHYLISSWRQQEQARRLPP
GPRRLPVIGHLHLLRPPVHRTFQELASRMGPLMHIQLGSTHCVVASSPEVASELIRGHEG
SISERPLTAVARQFAYDSAGFAFAPYNTHWRFMKRLCMSELLGPRTVEQLRPIRRAGTVS
LLGDLLLAAASSETETETVVDLTRHLIRLSNTSIIRMVASTVPGSVTDEAQELVKAVAEL
VGAFNADDYIAVIRGWDLQGLRRRAADVHRRFDALLEDILKHKEEARAARRRLDDDDGHR
VSKKQATAPHSKDLLDILMDKAEDPAAEVKLTRENIKAFIIDVVTAGSDTSAAMVEWMLA
ELLNHPETLRKVVEEIDAVVGGDRIASEADLPQLPYLMAAYKETLRLHPAAPIAHRQSTD
EMVVRGFTVPPQTAVFINVWAIGRDPAYWEEPLAFRPERFMPGGAADSLEPRGQHFQYMP
FGSGRRGCPGMGLALQSVPAVLAALVQCFHWATVDGDGDGDSKIDMSESDGLVCARKKPL
LLRPTPRLSPFPAVV
NT seq 1668 nt   +upstreamnt  +downstreamnt
atggcggccatggaagagcagccgctgagctccagcagtaccagcatggccatcgtcctg
tcgctcttgaagaacaacccagctgatgccgtcctgctggcactggtcgccgtcgtggcc
ttgcgccattacttgatctcgtcatggcggcagcaggagcaggcccgccggctgcccccg
ggcccaaggaggctcccggtgatcgggcacctgcacctgctccggccgccggtgcaccgc
accttccaggagctggcgtcccggatgggtcccctgatgcacatccagctggggtccacg
cactgcgtggtggccagctccccggaggtggccagcgagctgatccgcggccacgagggc
agcatctcggagcggccgctcacggcggtggcccggcagttcgcctacgactcggcgggc
ttcgccttcgcgccctacaacacgcactggcgcttcatgaagcgcctctgcatgtcggag
ctgctcggcccgcgcaccgtcgagcagctgcgccccatccgccgtgccggcaccgtgtcc
ctgctgggggacctgctgctggcggcggcgtcgtcggagacggagacggagacggtggtg
gacctcacccgccacctcatccgcctgtccaacacctccatcatccggatggtggccagc
accgtccccggcagcgtcaccgacgaggcgcaggagctggtcaaggccgtggccgagttg
gtcggcgccttcaacgccgacgactacatcgcggtgatccgtggctgggacctccagggc
ctccgcaggagagctgccgacgtccaccgccgcttcgacgccctgctggaggacatcctc
aagcacaaggaggaggcaagggcggcgcgacgaaggctcgacgacgacgacggccatcga
gtcagcaagaagcaggcgacggcgccgcacagcaaggacctgctcgacatcctcatggac
aaggcggaggacccggcggcggaggtcaagctcaccagggaaaacataaaggccttcatc
atcgacgtcgtgacggctggctccgatacgtcggcggccatggtggagtggatgctggcg
gagctgctgaaccatccggagacgctgcgcaaggtggtggaggagatcgacgcggtggtc
ggcggcgacaggatcgccagcgaggcggacctgccgcagctgccgtacctgatggcggcg
tacaaggagacgctgcggctgcacccggcggcgccgatcgcgcaccggcagtcgacggac
gagatggtggtgcgcggcttcacggtgccgcctcagacagcggtgttcatcaacgtgtgg
gccatcgggcgcgacccggcctactgggaggagcccctggcgttccggccggagcggttc
atgcccggcggcgccgccgacagcctcgagccccgcggccagcacttccagtacatgcca
ttcggcagcggccgccggggatgccccggcatgggcctcgcgctgcagtccgtgccggct
gtgctggcggcgctcgtgcagtgcttccactgggccaccgtcgacggcgacggcgacggc
gactccaagatcgacatgtcggagtcggacgggctggtgtgcgctcgcaagaagccgctc
ctgctccgccctacacctcgcctcagccccttcccggccgtcgtctag

DBGET integrated database retrieval system