KEGG   Sorghum bicolor (sorghum): 8060013
Entry
8060013           CDS       T01086                                 

Name
(RefSeq) parkeol synthase
  KO
K19010  parkeol synthase [EC:5.4.99.47]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    8060013
Enzymes [BR:sbi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.47  parkeol synthase
     8060013
SSDB
Motif
Pfam: SQHop_cyclase_C SQHop_cyclase_N Prenyltrans TED_complement
Other DBs
NCBI-GeneID: 8060013
NCBI-ProteinID: XP_021316678
Position
5:complement(14236335..14266751)
AA seq 766 aa
MWRLKVSERSSPWLGSVNNLLGRQEWVLDPDDLGTPEERAQVDRARREFADHRFERKHSS
DLLMRIQYAKENPHNHLGDLPPAVKLQENDDDIITEEAVWTSVKRAVNRVCNLQAHDGHW
PADYGGLLFLMPGLIITLYVSGVLNAVLSSEHQIEILRYIYNHQNEDGGWGLHIEGHSTM
LSSALNYVALRLLGECPNGGDGAMEKGRNWILDHGGAIFMAAWGKFWLSVLGVYDWSGNN
PVPPELWLLPHYLPFHPGRVVCYCRMVYMPMSYIYGRRFVGPITPLVLELRKELYTDAYD
EIDWNKARTECAKEDMYKPHSLVLDISMTILHKFEQIMFHWPWRKLRNKALAFTMRHVHY
EDESTHYINLGGVPKVLNMLARWIEDPNSEAFKCHIARVYDFLWIAEDGMKMQIYDGSQL
WDATFTVEVLLATGLVKELGPTLKRAHSFIKNSQLLENCLGDLNYWHRHISKGGWTFSTA
DDGWQVSDCSANGLKVCLLLSTISPEIVGEPLEIERQFDAVNCLMSLMNNDGGFSAFEPT
RSSPWLEHINPSEAFGRTMIDYPYVECTSSAIQCLALFRKLNPGHRKEEVENCINKGADF
IENIQRTDGSWYGSWGVCFTYATWFGVSGLVCAGRTFENSTAIRKACDFLLSKELPCGGW
GESWLSSHNEVYTNLRGNRHHGTHTAWALLALIEAGQAERDPMPLHRAAKTLLNLQLEDG
EFPQQEIIGVFMQTAMASYSQYRNIFPIWALTEYRRRVLLAGKKSE
NT seq 2301 nt   +upstreamnt  +downstreamnt
atgtggaggctcaaagtgtcggagcgcagcagcccatggcttgggtcagtgaacaacctc
ctcgggaggcaagagtgggtgttggatcccgacgacctcggcacgccggaggagcgcgcc
caggttgacagggcacgccgggagttcgccgaccaccgattcgaacgcaagcattctagt
gacctcctcatgcggatccagtacgctaaagaaaaccctcataatcatctgggcgacctt
cccccggctgtgaagcttcaagagaatgacgacgacattattacggaggaagccgtgtgg
acctctgtgaagcgagcagtaaaccgtgtatgtaatttgcaggcacatgatggacactgg
cctgcggattacggaggacttctcttccttatgccaggcttgattataacattatatgtg
agtggagttctcaacgctgttttatcatcggaacatcagatagagatacttcggtacatc
tacaatcatcagaatgaagatggagggtggggattgcacatcgagggccacagcaccatg
ctcagctcagccttgaactatgttgctttgagattgcttggggagtgcccaaatggcgga
gatggagccatggagaaaggccgaaactggatactggatcatggaggagccatatttatg
gcagcatggggaaagttttggctctcagtactcggagtatatgattggtccggaaataac
ccggtaccaccagaattgtggctactaccacattacctgccgtttcacccaggtcgagtg
gtttgctattgccgaatggtgtatatgcccatgtcttacatttatggaaggaggttcgtt
ggccccataacaccactagtactggaattaagaaaagagctgtacacagacgcctacgat
gagattgactggaacaaagctcgtactgaatgtgctaaggaagatatgtacaaaccacat
tcattggttctggatatctcaatgaccattctccacaagtttgaacaaattatgttccat
tggccttggagaaaactgaggaacaaggctctggcatttaccatgaggcacgttcactat
gaggatgagagcactcactacatcaaccttggtggtgtacccaaggtattaaatatgctt
gctcgctggattgaagatcctaactcagaagcattcaaatgccatattgcacgagtatat
gatttcttgtggattgccgaagatggcatgaagatgcagatatatgacggaagccagttg
tgggacgcaactttcacggttgaggtccttttggccaccggccttgtcaaagagcttgga
ccaactcttaaacgagcacattcctttattaagaattctcagttgcttgaaaattgcctg
ggagatttgaactactggcatcgccatattagcaaaggtggatggacgtttagtacagca
gatgatggttggcaagtttcagattgctctgcaaatggactaaaggtgtgtctattgttg
tcaacgatctctcctgaaattgttggtgaaccactggaaatcgagagacagtttgatgct
gttaattgtttgatgtctttgatgaataatgatggtggcttttcagcatttgaacccaca
aggtcttcaccatggctcgagcatatcaatccttctgaggcatttggacgcacaatgata
gattacccgtatgtcgaatgtacatcatcagcaattcagtgtctagcactttttagaaaa
cttaaccctgggcaccgcaaggaagaggtggaaaattgtatcaacaaaggggctgatttc
attgagaatattcaaagaacagatggttcatggtacggctcttggggagtttgttttacc
tatgccacatggtttggggtgagtggactagtttgtgctggcaggacatttgagaatagt
actgcaatcagaaaggcatgtgattttctattgtcaaaagagcttccttgtggtggctgg
ggagagagctggttgtcatctcataatgaggtttacacaaatcttagaggtaatcgacat
catggtacgcacactgcatgggccttgctggcactaattgaggctggacaggctgaaaga
gatccaatgcctctgcatcgggcagcaaagactttactcaacttacagttagaagacggt
gaattcccacagcaagagatcattggagttttcatgcaaactgccatggctagctactcc
caatacaggaatatcttccctatatgggctctcacagagtaccgccgtcgggtgttgctt
gcgggcaagaaatcggaatga

DBGET integrated database retrieval system