KEGG   Saimiri boliviensis boliviensis (Bolivian squirrel monkey): 101037403
Entry
101037403         CDS       T04350                                 

Definition
(RefSeq) cytochrome P450 3A21
  KO
K17689  cytochrome P450 family 3 subfamily A4 [EC:1.14.13.32 1.14.14.55 1.14.14.56 1.14.14.57 1.14.14.73 1.14.14.-]
Organism
sbq  Saimiri boliviensis boliviensis (Bolivian squirrel monkey)
Pathway
sbq00140  Steroid hormone biosynthesis
sbq00591  Linoleic acid metabolism
sbq00830  Retinol metabolism
sbq00980  Metabolism of xenobiotics by cytochrome P450
sbq00982  Drug metabolism - cytochrome P450
sbq00983  Drug metabolism - other enzymes
sbq01100  Metabolic pathways
sbq04976  Bile secretion
sbq05204  Chemical carcinogenesis - DNA adducts
sbq05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:sbq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    101037403
   00591 Linoleic acid metabolism
    101037403
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101037403
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101037403
   00982 Drug metabolism - cytochrome P450
    101037403
   00983 Drug metabolism - other enzymes
    101037403
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    101037403
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis - DNA adducts
    101037403
   05207 Chemical carcinogenesis - receptor activation
    101037403
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:sbq00199]
    101037403
Enzymes [BR:sbq01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.32  albendazole monooxygenase
     101037403
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.55  quinine 3-monooxygenase
     101037403
    1.14.14.56  1,8-cineole 2-exo-monooxygenase
     101037403
    1.14.14.57  taurochenodeoxycholate 6alpha-hydroxylase
     101037403
    1.14.14.73  albendazole monooxygenase (sulfoxide-forming)
     101037403
    1.14.14.-  
     101037403
Cytochrome P450 [BR:sbq00199]
 Cytochrome P450, animal type
  CYP3 family
   101037403
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 101037403
NCBI-ProteinID: XP_003934265
UniProt: Q0PPV0
Position
Unknown
AA seq 503 aa
MDFIPNLAVETWLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFFGTVLSYRQGFWKF
DMECYKKYGKVWGIYDGRQPVLAIADPNIIKTVLVKECYSVFTNRRPFGPVGFMKSAISI
AEDEEWKRIRSLLSPTFTSGKLKEMVPIIAQYGEVLVKNLRREAEKGKPINMKDIFGAYS
MDVITGTSFGVNIDSLNNPKDPFVENTRKLIRFDFSDPFFLSIILFPFLTPIFEALNISM
FPRDSTSFLRKSIKRIKESRLKDTHKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSI
IFIFAGYETTSSTLSFIMYELATHPDVQQKLQEEIDAVLPNKAPATYDTVLQMEYLDMVV
NETLRLFPLAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHYDPKYWTEPEKFLPERFS
KNNKDNIDPYIYTPFGTGPRNCIGMRFALMNMKLALIRILQNFSFKPCKETQIPLKLRSG
GLLQTEKPIVLKVEPRDGTVSGA
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggatttcatcccaaacttggccgtcgaaacctggcttctcctggctgtcagcctggtg
ctcctgtatctatatggaactcattcacatgggctttttaagaagcttggaattccggga
cccacacctctgccctttttcggaactgttttgtcctaccgtcagggcttttggaagttt
gacatggaatgttataaaaagtatggaaaagtgtgggggatttatgatggtcgacagcct
gtgctggctatcgcagatcccaacataatcaaaacagtgctagtgaaagaatgttactct
gtcttcactaaccggaggcctttcggtccggtgggatttatgaaaagtgccatctctata
gctgaggatgaagaatggaagagaatacgatcattgctgtctccaaccttcaccagtgga
aaactcaaggagatggtccctatcattgcccagtatggagaggtgttggtgaaaaacctg
aggcgggaagcagagaaaggcaagcccatcaacatgaaagacatctttggagcctacagc
atggatgtgatcactggcacatcatttggagtgaacatcgactctctcaacaatccaaaa
gacccctttgtggaaaacaccaggaagcttataagatttgacttttcagatccattcttt
ctctcaataatactcttcccattccttaccccaatttttgaagcattaaatatttctatg
tttccaagagattctacaagttttttaagaaaatctataaaaaggataaaagaaagtcgc
ctcaaagatacacataagcaccgagtggatttccttcagttgatgattgactcccagaat
tcgaaagaaactgagtcccacaaagctctgtctgatctggagctcgtggcccaatcaatt
atctttatttttgctggctatgaaaccaccagcagtactctttccttcattatgtatgaa
ctggccactcaccctgatgtccagcagaaactgcaggaggaaattgatgcagttttaccc
aacaaggcaccagccacctatgatactgtgctacagatggagtatcttgacatggtggtg
aatgaaacactcagattattcccacttgctatgagactggagagggtctgcaaaaaagat
gttgaaatcaatgggatgttcattcccaaaggggtagtggtgatgattccaagctatgct
cttcactatgacccaaagtactggacagagcctgagaagttcctccctgaaaggttcagt
aagaataacaaggacaacatagatccttacatatacacaccctttggaactggacccaga
aactgcattggcatgaggtttgctctcatgaacatgaaacttgctctaatcagaatcctt
cagaacttctccttcaagccttgtaaagaaacacagatccccctgaaattacgctcagga
ggacttcttcaaacagaaaaacccattgttctaaaggttgagccaagggatgggactgta
agtggagcctga

DBGET integrated database retrieval system