KEGG   Saccharomyces cerevisiae (budding yeast): YAL033W
Entry
YAL033W           CDS       T00005                                 

Gene name
POP5, FUN53
Definition
(RefSeq) RNA-binding protein POP5
  KO
K03537  ribonuclease P/MRP protein subunit POP5 [EC:3.1.26.5]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03008  Ribosome biogenesis in eukaryotes
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YAL033W (POP5)
   03008 Ribosome biogenesis in eukaryotes
    YAL033W (POP5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sce03009]
    YAL033W (POP5)
   03016 Transfer RNA biogenesis [BR:sce03016]
    YAL033W (POP5)
   03029 Mitochondrial biogenesis [BR:sce03029]
    YAL033W (POP5)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     YAL033W (POP5)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic type
  Pre-60S particles
   RNases
    RNase MRP
     YAL033W (POP5)
Transfer RNA biogenesis [BR:sce03016]
 Eukaryotic type
  5'processing factors
   Ribonucrease P
    YAL033W (POP5)
Mitochondrial biogenesis [BR:sce03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    YAL033W (POP5)
SSDB
Motif
Pfam: RNase_P_Rpp14 RnfC_N
Other DBs
NCBI-GeneID: 851200
NCBI-ProteinID: NP_009369
SGD: S000000031
UniProt: P28005
Structure
PDB: 
6AH3 6AGB

Position
I:82706..83227
AA seq 173 aa
MVRLKSRYILFEIIFPPTDTNVEESVSKADILLSHHRASPADVSIKSILQEIRRSLSLNL
GDYGSAKCNSLLQLKYFSNKTSTGIIRCHREDCDLVIMALMLMSKIGDVDGLIVNPVKVS
GTIKKIEQFAMRRNSKILNIIKCSQSSHLSDNDFIINDFKKIGRENENENEDD
NT seq 522 nt   +upstreamnt  +downstreamnt
atggtacgtttaaaaagtagatatatcctttttgaaattatattcccacctacagacacc
aacgttgaggaatctgtgtcgaaagcagacatcttgctttcgcatcacagagcatcgcct
gcggatgtgtccataaagtcgatactccaagagatacgacgctcgctgtcgttgaatctg
ggcgactatgggtctgcaaaatgtaactctctcttgcagttgaaatacttttcaaataag
acgtctacggggataatccgatgccatcgagaggattgcgaccttgttatcatggcattg
atgttgatgtcgaaaattggcgacgtcgatggactgatcgtgaaccccgtcaaggtaagt
gggaccatcaagaaaatagagcagtttgctatgagaaggaattctaaaattctgaacata
atcaagtgtagtcaatcatcacacctcagcgataatgactttattatcaatgatttcaag
aaaattggaagggaaaacgaaaacgaaaacgaggacgattag

KEGG   Saccharomyces cerevisiae (budding yeast): YBL018C
Entry
YBL018C           CDS       T00005                                 

Gene name
POP8
Definition
(RefSeq) ribonuclease P
  KO
K14528  ribonuclease P/MRP protein subunit POP8 [EC:3.1.26.5]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03008  Ribosome biogenesis in eukaryotes
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YBL018C (POP8)
   03008 Ribosome biogenesis in eukaryotes
    YBL018C (POP8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sce03009]
    YBL018C (POP8)
   03016 Transfer RNA biogenesis [BR:sce03016]
    YBL018C (POP8)
   03029 Mitochondrial biogenesis [BR:sce03029]
    YBL018C (POP8)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     YBL018C (POP8)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic type
  Pre-60S particles
   RNases
    RNase MRP
     YBL018C (POP8)
Transfer RNA biogenesis [BR:sce03016]
 Eukaryotic type
  5'processing factors
   Ribonucrease P
    YBL018C (POP8)
Mitochondrial biogenesis [BR:sce03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    YBL018C (POP8)
SSDB
Other DBs
NCBI-GeneID: 852263
NCBI-ProteinID: NP_009535
SGD: S000000114
UniProt: P38208
Structure
PDB: 
6AH3 6AGB

Position
II:complement(join(185998..186352,186428..186474))
AA seq 133 aa
MGKKTFREWQYFKLSITSFDQDVDDAHAIDQMTWRQWLNNALKRSYGIFGEGVEYSFLHV
DDKLAYIRVNHADKDTFSSSISTYISTDELVGSPLTVSILQESSSLRLLEVTDDDRLWLK
KVMEEEEQDCKCI
NT seq 402 nt   +upstreamnt  +downstreamnt
atggggaaaaagacttttagagaatggcaatatttcaagttatcaattacttcattcgat
caagatgtggacgatgcacatgctattgatcaaatgacatggaggcaatggttaaataac
gcattgaaacgtagttatggtatttttggtgaaggtgtagaatattcattcctgcatgtt
gacgataagctggcttacatcagagtaaatcatgcggataaagatacattttcttcgtcc
atcagtacatacatatctactgatgaactcgtcggttcaccattaacagtgtcaattcta
caagaatcttccagtttgagacttctggaggttactgacgatgaccgcctatggctgaaa
aaagtaatggaagaagaagaacaagactgtaaatgtatatag

KEGG   Saccharomyces cerevisiae (budding yeast): YBR167C
Entry
YBR167C           CDS       T00005                                 

Gene name
POP7, RPP2
Definition
(RefSeq) ribonuclease P/MRP protein subunit POP7
  KO
K14526  ribonuclease P/MRP protein subunit POP7 [EC:3.1.26.5]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03008  Ribosome biogenesis in eukaryotes
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YBR167C (POP7)
   03008 Ribosome biogenesis in eukaryotes
    YBR167C (POP7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sce03009]
    YBR167C (POP7)
   03016 Transfer RNA biogenesis [BR:sce03016]
    YBR167C (POP7)
   03029 Mitochondrial biogenesis [BR:sce03029]
    YBR167C (POP7)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     YBR167C (POP7)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic type
  Pre-60S particles
   RNases
    RNase MRP
     YBR167C (POP7)
Transfer RNA biogenesis [BR:sce03016]
 Eukaryotic type
  5'processing factors
   Ribonucrease P
    YBR167C (POP7)
Mitochondrial biogenesis [BR:sce03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    YBR167C (POP7)
SSDB
Motif
Pfam: Rpp20 Alba PHM7_cyt
Other DBs
NCBI-GeneID: 852465
NCBI-ProteinID: NP_009726
SGD: S000000371
UniProt: P38291
Structure
PDB: 
3IAB 6AH3 6AGB

Position
II:complement(571468..571890)
AA seq 140 aa
MALKKNTHNKSTKRVTKHPSLKTLTHKQIHTTIFVKSTTPYVSALKRINKFLDSVHKQGS
SYVAVLGMGKAVEKTLALGCHFQDQKNKKIEVYTKTIEVLDEVITEGQADIDMESDVEDD
DKETQLKKRAVSGVELRIYV
NT seq 423 nt   +upstreamnt  +downstreamnt
atggcactcaaaaagaatacacacaacaaatctaccaaacgagtaacgaaacacccatct
ttgaaaactctaacgcataagcaaatacacacaacaattttcgttaagtctacaacacca
tacgttagtgcactgaaaagaataaataagtttctcgatagcgttcataagcaaggatca
tcctatgttgcggttttgggtatgggtaaagctgtagaaaagacactggcattaggttgt
cattttcaagatcagaagaacaagaaaatagaggtttacactaaaactatagaagttctt
gatgaagtaataactgaaggccaagctgatatcgacatggaaagtgatgttgaagatgac
gataaagaaacccaactaaagaaaagggctgtaagcggtgtagaattgcgtatttatgtt
taa

KEGG   Saccharomyces cerevisiae (budding yeast): YBR257W
Entry
YBR257W           CDS       T00005                                 

Gene name
POP4
Definition
(RefSeq) RNase P/RNase MRP complex subunit
  KO
K03538  ribonuclease P protein subunit POP4 [EC:3.1.26.5]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03008  Ribosome biogenesis in eukaryotes
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YBR257W (POP4)
   03008 Ribosome biogenesis in eukaryotes
    YBR257W (POP4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sce03009]
    YBR257W (POP4)
   03016 Transfer RNA biogenesis [BR:sce03016]
    YBR257W (POP4)
   03029 Mitochondrial biogenesis [BR:sce03029]
    YBR257W (POP4)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     YBR257W (POP4)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic type
  Pre-60S particles
   RNases
    RNase MRP
     YBR257W (POP4)
Transfer RNA biogenesis [BR:sce03016]
 Eukaryotic type
  5'processing factors
   Ribonucrease P
    YBR257W (POP4)
Mitochondrial biogenesis [BR:sce03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    YBR257W (POP4)
SSDB
Motif
Pfam: RNase_P-MRP_p29 DUF3245 DNApol_Exo
Other DBs
NCBI-GeneID: 852560
NCBI-ProteinID: NP_009816
SGD: S000000461
UniProt: P38336
Structure
PDB: 
6AH3 6AGB

Position
II:728885..729724
AA seq 279 aa
MDRTQTFIKDCLFTKCLEDPEKPFNENRFQDTLLLLPTDGGLTSRLQRQQRKSKLNLDNL
QKVSQLESADKQLEKRDYQRINKNSKIALREYINNCKKNTKKCLKLAYENKITDKEDLLH
YIEEKHPTIYESLPQYVDFVPMYKELWINYIKELLNITKNLKTFNGSLALLKLSMADYNG
ALLRVTKSKNKTLIGLQGIVIWDSQKFFIMIVKGNIIDEIKCIPKKGTVFQFEIPISDDD
DSALRYSILGDRFKYRSVDRAGRKFKSRRCDDMLYYIQN
NT seq 840 nt   +upstreamnt  +downstreamnt
atggatagaactcaaacgtttattaaagactgtcttttcacgaaatgcctggaggaccct
gaaaagccctttaatgaaaatagatttcaagatacgttgttgctactgccaactgatggc
ggattgacttcaaggcttcagagacagcaaagaaaatcaaagctaaatcttgacaattta
caaaaggtctcccagttagagagtgcagacaaacagttggaaaaaagagattaccaaaga
atcaacaagaactctaaaatcgcattaagagagtacatcaataattgtaaaaaaaataca
aaaaaatgtctgaaattggcatacgaaaataaaattactgataaggaagaccttttacac
tacatagaggagaagcatccaacgatatacgaatcattaccgcagtacgttgattttgta
ccgatgtataaggaactatggattaactatattaaagaacttttgaacattacaaaaaac
ttaaaaacattcaatggatcattagcattattaaaactatctatggcagactataatggt
gcgctgttacgcgttacaaagagcaaaaataagactttaataggccttcaaggcattgtg
atctgggactctcagaaattttttatcatgattgtcaagggcaatataatagacgaaata
aaatgcattccaaaaaagggcacagtatttcaatttgaaatcccaatatcagatgacgac
gattcggcattgagatatagtatactaggcgataggttcaagtacagaagtgtggatcgt
gcaggcaggaagttcaaaagtcgtcgttgtgatgatatgctatattatatacagaattag

KEGG   Saccharomyces cerevisiae (budding yeast): YGR030C
Entry
YGR030C           CDS       T00005                                 

Gene name
POP6
Definition
(RefSeq) ribonuclease P/MRP protein subunit POP6
  KO
K14524  ribonuclease P/MRP protein subunit POP6 [EC:3.1.26.5]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03008  Ribosome biogenesis in eukaryotes
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YGR030C (POP6)
   03008 Ribosome biogenesis in eukaryotes
    YGR030C (POP6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sce03009]
    YGR030C (POP6)
   03016 Transfer RNA biogenesis [BR:sce03016]
    YGR030C (POP6)
   03029 Mitochondrial biogenesis [BR:sce03029]
    YGR030C (POP6)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     YGR030C (POP6)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic type
  Pre-60S particles
   RNases
    RNase MRP
     YGR030C (POP6)
Transfer RNA biogenesis [BR:sce03016]
 Eukaryotic type
  5'processing factors
   Ribonucrease P
    YGR030C (POP6)
Mitochondrial biogenesis [BR:sce03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    YGR030C (POP6)
SSDB
Motif
Pfam: Alba HTH_34
Other DBs
NCBI-GeneID: 852918
NCBI-ProteinID: NP_011544
SGD: S000003262
UniProt: P53218
Structure
PDB: 
3IAB 6AH3 6AGB

Position
VII:complement(545681..546157)
AA seq 158 aa
MINGVYYNEISRDLDISSSTQCLRFLKETVIPSLANNGNNSTSIQYHGISKNDNIKKSVN
KLDKQINMADRSLGLQQVVCIFSYGPHIQKMLSILEIFKKGYIKNNKKIYQWNKLTSFDI
KREGRNELQEERLKVPILVTLVSDSEIIDLNLHSFTKQ
NT seq 477 nt   +upstreamnt  +downstreamnt
atgatcaatggcgtatattacaatgaaattagtagagatttggatatctcttcctccact
caatgtcttcggtttctcaaagaaacagttataccgtccttagcaaataatggtaacaac
agtacatcaatacagtatcatggcatatcgaagaacgataacattaagaagtctgtaaat
aagttagataaacaaatcaacatggcagatagaagtttgggtctacaacaagtagtttgt
atattctcttacggtccacatattcaaaaaatgttaagtattttggaaatatttaaaaag
ggttatattaagaacaataagaaaatttatcagtggaataaattaacatcgttcgatata
aaaagagaaggcagaaatgaactacaggaagaaaggctcaaggttccaattttggtcacc
cttgtttctgattcagagatcattgatttaaacctacattcattcaccaaacaataa

KEGG   Saccharomyces cerevisiae (budding yeast): YHR062C
Entry
YHR062C           CDS       T00005                                 

Gene name
RPP1
Definition
(RefSeq) RNA-binding RNA processing protein RPP1
  KO
K03539  ribonuclease P/MRP protein subunit RPP1 [EC:3.1.26.5]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03008  Ribosome biogenesis in eukaryotes
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YHR062C (RPP1)
   03008 Ribosome biogenesis in eukaryotes
    YHR062C (RPP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sce03009]
    YHR062C (RPP1)
   03016 Transfer RNA biogenesis [BR:sce03016]
    YHR062C (RPP1)
   03029 Mitochondrial biogenesis [BR:sce03029]
    YHR062C (RPP1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     YHR062C (RPP1)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic type
  Pre-60S particles
   RNases
    RNase MRP
     YHR062C (RPP1)
Transfer RNA biogenesis [BR:sce03016]
 Eukaryotic type
  5'processing factors
   Ribonucrease P
    YHR062C (RPP1)
Mitochondrial biogenesis [BR:sce03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    YHR062C (RPP1)
SSDB
Motif
Pfam: RNase_P_p30
Other DBs
NCBI-GeneID: 856459
NCBI-ProteinID: NP_011929
SGD: S000001104
UniProt: P38786
Structure
PDB: 
6AH3 6AGB

Position
VIII:complement(222877..223758)
AA seq 293 aa
MLVDLNVPWPQNSYADKVTSQAVNNLIKTLSTLHMLGYTHIAINFTVNHSEKFPNDVKLL
NPIDIKRRFGELMDRTGLKLYSRITLIIDDPSKGQSLSKISQAFDIVAALPISEKGLTLS
TTNLDIDLLTFQYGSRLPTFLKHKSICSCVNRGVKLEIVYGYALRDVQARRQFVSNVRSV
IRSSRSRGIVIGSGAMSPLECRNILGVTSLIKNLGLPSDRCSKAMGDLASLVLLNGRLRN
KSHKQTIVTGGGSGNGDDVVNDVQGIDDVQTIKVVKRSMDAEQLGHASKRHKP
NT seq 882 nt   +upstreamnt  +downstreamnt
atgctggtagatttgaatgtaccgtggccacagaacagctatgcagacaaagttacttct
caggcggtcaacaatttaataaaaacgttatccacattgcatatgttgggatatacacac
atcgccataaattttacagtaaaccacagcgagaaattccccaacgatgttaagctgtta
aatcctatcgatatcaagagaaggtttggagaattgatggatcgaacagggctaaaatta
tacagcaggatcacgctaattatcgacgatccatcgaagggacagtctctttccaagata
agccaggcctttgatattgtagcagcattgccaatcagtgaaaagggccttactttatca
actaccaatctggatattgacttgttgacctttcagtacgggtcgcgcctgcctactttc
cttaagcataaaagcatatgcagctgtgtgaacagaggagtaaaacttgaaattgtttat
ggctatgctttgcgtgacgtacaagctcggaggcagttcgtatccaatgtaagaagcgtc
atcaggagttcgaggtccagaggcattgttatcggcagtggtgccatgtcaccacttgag
tgccgcaacatattaggagtaacaagtctaatcaagaatttaggtcttccgagcgatagg
tgttcgaaggccatgggagacctagcttcactcgtcctcctaaatggccgcttaaggaat
aagagccacaaacagaccattgttaccggtggtggtagcggaaacggcgatgacgtggtc
aacgatgttcaaggcatcgacgacgtccagaccatcaaggtagtgaaaaggagtatggat
gctgaacaattaggccatgcttccaaaagacacaagccttaa

KEGG   Saccharomyces cerevisiae (budding yeast): YIR015W
Entry
YIR015W           CDS       T00005                                 

Gene name
RPR2
Definition
(RefSeq) ribonuclease P protein subunit RPR2
  KO
K03540  ribonuclease P protein subunit RPR2 [EC:3.1.26.5]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YIR015W (RPR2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sce03016]
    YIR015W (RPR2)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     YIR015W (RPR2)
Transfer RNA biogenesis [BR:sce03016]
 Eukaryotic type
  5'processing factors
   Ribonucrease P
    YIR015W (RPR2)
SSDB
Motif
Pfam: Rpr2 zinc_ribbon_12
Other DBs
NCBI-GeneID: 854832
NCBI-ProteinID: NP_012280
SGD: S000001454
UniProt: P40571
Structure
PDB: 
6AH3 6AGB

Position
IX:381948..382382
AA seq 144 aa
MGKKAHGGKMKPEIDENGTLLVPPPRTIANQDHFHRLNYLYQISAYQTRARQKARTDAHT
PLARNYIKSMDLISKKTKTSLLPTIKRTICKKCHRLLWTPKKLEITSDGALSVMCGCGTV
KRFNIGADPNYRTYSEREGNLLNS
NT seq 435 nt   +upstreamnt  +downstreamnt
atgggcaagaaagcacacggaggaaagatgaaacctgagatcgacgaaaatggtactctg
ctagtaccgccaccaaggacgattgcgaaccaggaccatttccatagattaaactacctc
taccaaatatccgcttaccaaacaagagcaagacagaaagcaagaacagacgcacatacg
cctttggcacgcaattatatcaaatcaatggacctaattagtaagaaaaccaagacatca
ctgcttcctacgataaagagaacaatttgtaaaaaatgccatcggttgttatggacccca
aaaaaactggaaatcacatccgacggagcgctttcggtaatgtgtgggtgcggtaccgtt
aaacgttttaatattggcgccgatcctaattacaggacctactcggagcgggagggtaat
ctactaaattcttag

KEGG   Saccharomyces cerevisiae (budding yeast): YML091C
Entry
YML091C           CDS       T00005                                 

Gene name
RPM2
Definition
(RefSeq) ribonuclease P
  KO
K14533  ribonuclease P protein component, mitochondrial [EC:3.1.26.5]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YML091C (RPM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sce03016]
    YML091C (RPM2)
   03029 Mitochondrial biogenesis [BR:sce03029]
    YML091C (RPM2)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     YML091C (RPM2)
Transfer RNA biogenesis [BR:sce03016]
 Eukaryotic type
  5'processing factors
   Ribonucrease P
    YML091C (RPM2)
Mitochondrial biogenesis [BR:sce03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial ribonuclease P
    YML091C (RPM2)
SSDB
Motif
Pfam: RPM2
Other DBs
NCBI-GeneID: 854883
NCBI-ProteinID: NP_013619
SGD: S000004556
UniProt: Q02773
Position
XIII:complement(87123..90731)
AA seq 1202 aa
MAFKSFIYSKGYHRSAAQKKTATSFFDSSYQYLRQNQGLVNSDPVLHASHLHPHPVVVAN
VNYNNVDDILHPHDLDSSINNTNNPLTHEELLYNQNVSLRSLKQQQSTNYVNNNNNNQHR
YYSTGPTLPTNQYDPLNFSNRNFQDLSLKTSQPSVQQPQNEYSLLKDENAPVWKEDTEPC
LNKSTYLQTHIDEINRCYEQKNYNKINSLYQSLKRNDIVPPLEIFTKVLDSLCKRPLDNN
DLDNKMYELLTCYQDMINNRLKPPDEIYNIVLLSLFKGSILAYQFENPNGSDFYKIAIEL
FNTTTNDPKQKSVVKFRNFSKDVLDYNLLAMNIYPGHITLSKAQQVIKSSPAFIKDSFYF
IACFSYAKLTNDKFAIKELYEDFRLSLSSGSPDQGLFDDQFEIYSVILSSFIETGEVELA
TNLLDDLVSKIQSSNGLASNISLLLSSFLISMSKVDPSKAYEIWFKFHNLNWIPEFSYEF
YLVFMANSFQDWNLTKKIYDYIFPMERNLSPLKKQKLSDYLLHPIGVDSITTSLLDYSLQ
LKDNEVIMKILEESIVKNFSFDIGIYPFVFNYLREIQCGEDYLMRFIESHAEFIKKSNSI
NKFQFLNMIVDNFQSQSLLNKISHAKFFKNFVEDFNLENCELVSYNGLISCINNFIKIPK
TIKDFPYILEIHAILVTKLFDFDTYPILQNGNNEVLLKFRDQIEHQFKMLAQNFCRLNLD
PNLLAGVVSQAMKMVNLDDTANGQDLLNFFNHPGDWDKSYPLSLGSFIRNSPRGGIREFT
KLSKEGYCFDYDTYKELIIKRAINKQIIDKCLEVCPDSIELKNIVNLMISKIPGRNLTQL
IINNPKFSKVFVPNLRNDSMLKLIENCESLSNFIRICDFPEKFKSIAIQAENKNAIELIY
ERLFDGGKYADILRYNNIVPVLNLELLLKSCIRSGEFKKYESLSKKFNDKISESSKIDIQ
LEYLINKNDLKGAFTLFEKTPRELRTPHKTMDLYTFALFLDSFNRNITYYESPENTLQFA
NILSSQTSFINLLSTYNLIAHSDHLMNFNVGGMAAKVKKEILNQMLNNLYDSIRLLSPSI
ENDKSMKEKLREKVKNYCRFKAYLKSPELDMDELKTLVSVESFLNPFTPSMLFNNLIETI
YINEHASSLVLQNGLIYSLQQKGLNKILSYLEESFITSGNDANIEKVREFRSLLRKSKPL
QA
NT seq 3609 nt   +upstreamnt  +downstreamnt
atggctttcaaatcattcatatactctaaaggttatcatcgttccgccgctcaaaagaaa
actgcaacatcttttttcgatagctcctaccagtatctaaggcaaaaccaaggtttggta
aattcggatcccgtacttcatgcatctcatctacatcctcatccggtcgtagtagcgaat
gtaaactataacaacgtagatgatattttgcatccgcacgacctggattctagcataaac
aacactaacaaccccctcacccacgaagaactactttataaccaaaacgtttcccttcga
tcgctgaagcagcagcaaagtacaaactatgttaataacaacaacaacaatcaacatagg
tattattctaccggccccacattaccaacaaaccaatatgaccccttaaactttagtaat
aggaacttccaagatctatcattaaaaacatcacaaccatcagtacaacagccacaaaat
gagtacagccttctaaaagacgaaaacgctccagtttggaaggaggacacagaaccatgc
ctgaataaatctacatacttgcaaactcatattgatgaaattaatcgttgttacgaacaa
aaaaattataacaaaatcaactctttatatcaatcattgaaaagaaatgatatcgttccg
ccactggaaatatttacgaaggttttggactctctttgcaaaaggccgctagataacaat
gatttagacaacaaaatgtacgaactcttgacgtgctaccaagatatgatcaacaataga
ttaaaacctcctgatgagatttataatattgtactattgtctcttttcaagggctcaatt
ttggcctatcagttcgaaaatccaaacggtagtgatttttacaaaattgccattgaatta
ttcaatacgaccaccaacgatccaaagcaaaaaagtgtggttaagtttcgcaatttttcc
aaagatgttctcgactataaccttttagcgatgaacatctatccgggccatatcaccctg
tcaaaagcccaacaagttattaaatcttcacctgcctttatcaaagattctttttacttc
atagcatgcttctcatacgctaaattaacaaatgataagtttgccattaaagaactttat
gaagatttcagactatctttatcatctggcagtccagaccaaggcttatttgatgaccag
tttgaaatttacagcgtgattctttctagttttattgaaactggcgaagttgaactggct
accaatcttttggacgatttagtttccaaaattcaaagctcaaatggtctcgcttccaat
atttctttattgctatcgagtttcttaatttcgatgagtaaggtagatccttcaaaagct
tatgaaatatggtttaaattccataatttaaattggatacctgagttctcttacgaattt
tatttggttttcatggcaaacagtttccaagattggaatttgactaagaaaatatatgac
tatatttttcctatggaaagaaatttgtctccattaaaaaaacaaaaattatcagattac
ttactgcatccaatcggtgttgactccattacgacctctttgttagattattctttacaa
ttgaaagataatgaagttattatgaaaattctagaagagtccattgtcaaaaatttttct
tttgatattggcatttatccatttgttttcaattatttaagagaaattcagtgcggcgag
gactaccttatgagatttattgaatcacacgctgagtttatcaagaagagcaactcaatt
aacaaatttcaattcttaaatatgatagttgataatttccaatcacaatcattattaaac
aaaatatcccacgcaaagtttttcaaaaacttcgtagaagatttcaatttagaaaactgt
gaattggtcagctataatgggctaatatcatgcattaataacttcattaaaattccaaag
acaataaaggatttcccatacattctggagattcatgcaattttggtaacaaaattattt
gattttgacacttacccaattttgcaaaatggcaacaacgaggttcttttgaagtttaga
gatcaaattgaacatcagtttaaaatgttagctcaaaacttctgcagattaaacctagat
cctaatttgttagcaggtgtcgtatctcaagctatgaaaatggttaacctagatgacacc
gctaatggacaagatttattgaactttttcaatcatccaggtgattgggacaaatcttat
cctttgtcactaggttctttcatcaggaactcacccagaggtggtataagagaatttacg
aaattgagcaaagaaggttattgctttgattatgacacttataaagaattgataattaaa
cgagctattaacaaacaaattattgacaagtgcttagaggtatgccctgattcaattgaa
ctaaaaaatatcgtaaatttgatgatttcaaagattcctggtaggaacctaacccaattg
ataatcaataatccaaaatttagcaaagtttttgtgccaaatttaagaaatgattctatg
ttaaaattaatcgaaaactgcgaatctttatcgaatttcataagaatctgtgatttccca
gaaaagttcaaaagtattgctattcaagccgaaaacaaaaatgctattgagctgatttat
gaaagactgtttgacggcggtaagtacgcagatattttgagatataataatattgttccg
gtgttaaatttggaacttttattaaaatcttgtatcaggtctggtgaattcaagaagtat
gaaagtctctctaaaaagtttaatgacaaaataagcgaatcatcaaaaattgatattcag
ctagaatatttaattaataagaatgatttaaaaggggcattcacgctgtttgaaaagact
ccaagggagctgagaaccccccataagactatggacctttatacatttgccttatttttg
gatagtttcaataggaacatcacgtattatgaaagtccggaaaatacattacaattcgcc
aatattttatccagccaaacaagcttcataaatttactatcgacgtacaacttaattgcc
cattcagatcacctcatgaacttcaacgtcggtggaatggcagcaaaagttaaaaaagaa
atcctgaatcaaatgctaaacaatttgtatgattccatcagactattgtctcccagcatt
gaaaatgacaaatcaatgaaggaaaaattgagagaaaaagtaaagaactactgcagattc
aaagcttatttgaagtcacctgaattggacatggatgaactgaagaccttggtttcagtc
gagtcttttttaaatcctttcactccttcaatgttgttcaataacttgatcgaaactatt
tatataaacgaacacgcttcctcgttagtccttcagaatgggttgatctattcactccaa
cagaaaggtctcaataagatactgagctatctagaagaaagcttcatcactagtggaaat
gatgccaatattgaaaaggtcagggaattcaggtcccttttaaggaagagcaagcctctt
caagcatga

KEGG   Saccharomyces cerevisiae (budding yeast): YNL221C
Entry
YNL221C           CDS       T00005                                 

Gene name
POP1
Definition
(RefSeq) ribonuclease P/MRP protein subunit POP1
  KO
K01164  ribonuclease P/MRP protein subunit POP1 [EC:3.1.26.5]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03008  Ribosome biogenesis in eukaryotes
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YNL221C (POP1)
   03008 Ribosome biogenesis in eukaryotes
    YNL221C (POP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sce03009]
    YNL221C (POP1)
   03016 Transfer RNA biogenesis [BR:sce03016]
    YNL221C (POP1)
   03029 Mitochondrial biogenesis [BR:sce03029]
    YNL221C (POP1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     YNL221C (POP1)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic type
  Pre-60S particles
   RNases
    RNase MRP
     YNL221C (POP1)
Transfer RNA biogenesis [BR:sce03016]
 Eukaryotic type
  5'processing factors
   Ribonucrease P
    YNL221C (POP1)
Mitochondrial biogenesis [BR:sce03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    YNL221C (POP1)
SSDB
Motif
Pfam: POP1 POPLD
Other DBs
NCBI-GeneID: 855500
NCBI-ProteinID: NP_014178
SGD: S000005165
UniProt: P41812
Structure
PDB: 
6AH3 6AGB

Position
XIV:complement(231068..233695)
AA seq 875 aa
MSGSLSRGNGGKKVLNKNQLLKRNRIRNARSIRAEAVAASSTKTGTPSDLSESGSKLNVD
QFISSRQFEVKQLQLAMHNSKAASSTRIFQALPRKLRRRTASHNVRRIPKRMRNRALREM
RKSDQQDVLKGSSASSRKAHGLNAKQLYKARMSIKLLRLASKSTSMKLSMPPEVTSSNCH
VRQKIKTLKRMIKESSTANPNIKLLNNRMGSYDCTGVNELAPIPKGRVKYTKRQKHFAWL
PTHIWNAKRSHMMKRWGYQMVWAPTQKCFKLTHRLGGDTCSSDGALCMDSSYIGTIIVKD
KSNDSEGDFLKSIIGKLTAERANLRKYREGQVLFQGLIYSFNEENGEDSTKPLGPCDVFW
VQKDTAIIRLHPSIYTQVFNILLQHKEKLTVQDCRYSLASVTLKGAKALESLASCLRSTE
YSKSFEQFKMVSMITDHNALPQRCTFAFEAIDPRHLAAPKKLNDSQRKTVNSDDILSLHE
NYPQDEINAVFNELCDPESRTQSYNNQNTLKEISARRYKLLTATPNSINKTTVPFKESDD
PSIPLVIIRRLKTRDWIVVLPWFWLLPLWHLLNRIPRMYHIGLRQFQQIQYENKQLYFPD
DYPFTQLGYIENSFYKKEASKTKWDRKPMGKRINFEKIKDIHNTKLPAYSGEIGDFFSSD
WRFLQILRNGIDYLQRNDKTLELMDSKKTGQFNAQGVRDINCVNDVLEFCKDYEAKTKAM
SLSIEENIPVALCKNRKCQFRTPDSISVNSSSFSLTFFPRCIIAVSCTLLERGHPKDNAR
IYQVPEKDLEHWLQLAKGVYRPNGRKDHDLKIPLPEVHDLIGFITSGTYHLNCGNGMGIG
FIDHHAAIRQPTRYVLIRNVGTNTYRLGEWSKISV
NT seq 2628 nt   +upstreamnt  +downstreamnt
atgagcgggagtttgtctagaggaaatggtggaaagaaagttcttaataagaatcaatta
ctgaagcgaaatcgcataagaaatgctagatcaattagagcagaggccgtggccgcttca
tcaacaaaaactgggacaccgagtgatctgagtgaatcgggaagtaagctaaacgtggac
caattcattagttctcgacaattcgaggttaagcagttgcaattggccatgcataattcc
aaagcagccagctcaacgagaatatttcaggcattgcctcgaaaattgcgtcgtagaacg
gcttcgcataatgttcgtagaattccaaaaagaatgcgcaatagagctttgagggaaatg
cgtaaaagtgatcagcaggatgtgttgaaggggtcttcagcctcttccagaaaagctcat
ggcctaaatgcaaagcaactttataaagctagaatgtccataaagctgctacgattggct
agcaaatctacttctatgaaactcagcatgccaccagaggttacatcatctaactgccac
gtaaggcagaaaatcaagacattaaagcgaatgattaaagaatcatcaacagcaaatcca
aatataaagttacttaataatcgtatggggagctatgattgcactggtgtcaatgaatta
gcacctattcccaagggcagggtcaaatatacgaagagacagaagcactttgcttggcta
cccacccacatttggaatgctaaaaggtcgcacatgatgaaaagatggggatatcaaatg
gtatgggcacctactcaaaaatgctttaaattgacgcataggttgggcggtgatacctgc
agctccgatggggccttatgcatggattcaagttatattggtacaataattgtaaaagac
aaaagcaatgacagtgagggggactttttaaaatccattataggaaagttaacagctgaa
agagcaaacttaaggaaatatcgcgaaggccaggttttattccaagggttaatttatagt
ttcaatgaagaaaacggtgaggattctactaagccactgggtccatgcgacgtattttgg
gtacaaaaggatactgcaattataaggttacacccttcaatttatactcaggtttttaac
attcttttgcaacataaggaaaaactaacagtacaagattgtcgatattcattagcaagc
gtgacattgaagggagctaaagctctagagtcattagcatcgtgtttaaggagcacagag
tactctaaatcgtttgaacaatttaaaatggtttcaatgattaccgatcataatgcccta
ccacagaggtgtacgtttgcatttgaagccatagatccgcgtcatctagctgctccaaag
aaattaaatgattcacagaggaagactgttaattctgacgacattttatcactgcatgaa
aactatcctcaagacgaaataaacgccgtttttaacgaattatgtgaccctgaatcacgt
actcaatcatacaacaaccaaaacacattaaaagaaatttctgcgagacgttacaaattg
ctaactgccacaccgaacagcatcaataaaactacagtcccgttcaaagaaagtgacgat
ccttctattccattagtcataataagaaggctcaagaccagggattggattgttgtgtta
ccatggttctggctgctaccgttatggcatctactgaaccggataccaaggatgtatcac
attggcctcaggcaattccagcaaattcagtacgagaataagcaattatattttccggat
gattatccattcactcaattgggttatatagaaaactcattttataaaaaggaggcctcc
aagacgaagtgggataggaagccaatgggaaaaaggattaatttcgagaagatcaaagac
atccataacactaaattaccggcatatagcggagaaatcggcgattttttcagttcagac
tggagatttttacaaatactgagaaatggaattgattatttacagcggaatgataaaacc
ttagaactgatggacagtaagaagaccgggcaatttaacgctcagggtgtaagagacatc
aactgtgtaaatgatgttttggagttttgcaaagattatgaagccaagaccaaggctatg
tcgttgtcgattgaagagaacataccagttgcattgtgtaaaaatcggaaatgtcaattt
cgcactcctgatagcattagcgtcaatagttcttcattctcccttacattcttcccacgt
tgtatcattgctgtatcttgcacactactcgaacgaggtcacccaaaggacaatgcaaga
atatatcaagttccagaaaaggacttagagcattggctacaattggcaaaaggggtttac
cgcccaaacggaagaaaagatcatgatttgaaaattccacttccagaggtacatgatttg
attggttttattaccagcggcacctaccacttaaattgtggaaatggtatgggaatcgga
tttatagatcatcatgcggccatccggcaaccaactaggtatgtactgatcagaaatgta
ggtaccaacacttataggttgggggagtggtcgaaaatatccgtataa

KEGG   Saccharomyces cerevisiae (budding yeast): YNL282W
Entry
YNL282W           CDS       T00005                                 

Gene name
POP3
Definition
(RefSeq) Pop3p
  KO
K14522  ribonuclease P/MRP protein subunit POP3 [EC:3.1.26.5]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03008  Ribosome biogenesis in eukaryotes
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YNL282W (POP3)
   03008 Ribosome biogenesis in eukaryotes
    YNL282W (POP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sce03009]
    YNL282W (POP3)
   03016 Transfer RNA biogenesis [BR:sce03016]
    YNL282W (POP3)
   03029 Mitochondrial biogenesis [BR:sce03029]
    YNL282W (POP3)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     YNL282W (POP3)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic type
  Pre-60S particles
   RNases
    RNase MRP
     YNL282W (POP3)
Transfer RNA biogenesis [BR:sce03016]
 Eukaryotic type
  5'processing factors
   Ribonucrease P
    YNL282W (POP3)
Mitochondrial biogenesis [BR:sce03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    YNL282W (POP3)
SSDB
Motif
Pfam: RNase_P_pop3
Other DBs
NCBI-GeneID: 855439
NCBI-ProteinID: NP_014117
SGD: S000005226
UniProt: P53833
Structure
PDB: 
6AH3 6AGB

Position
XIV:107687..108274
AA seq 195 aa
MSGSLKSLDKKIAKRRQVYKPVLDNPFTNEAHMWPRVHDQPLIWQLLQSSIINKLIHIQS
KENYPWELYTDFNEIVQYLSGAHGNSDPVCLFVCNKDPDVPLVLLQQIPLLCYMAPMTVK
LVQLPKSAMDTFKSVSKYGMLLLRCDDRVDKKFVSQIQKNVDLLQFPWLNAIKYRPTSVK
LLKTTVPIVSKKRQK
NT seq 588 nt   +upstreamnt  +downstreamnt
atgtccgggtcgttaaaatctctagacaagaaaatagctaaaagaaggcaggtgtataag
cccgtgctagacaatccgttcacaaacgaagcacatatgtggccgcgcgtgcatgatcag
ccattgatttggcagctgctgcaatcctctatcataaataagttgattcacattcaatcg
aaggagaactacccttgggagctgtatacagatttcaatgaaattgtgcagtatttgagc
ggcgctcacggaaacagcgacccagtatgtctatttgtgtgcaataaggaccctgatgta
ccgcttgtgctcttgcagcaaatcccgctattatgctatatggcgcccatgacggttaaa
ctggtgcagttgcccaagagtgccatggataccttcaagtcggtttctaaatatggaatg
ctgctgctgcggtgcgacgatagggtcgacaagaaattcgtatcgcagatccagaagaac
gttgatctgcttcagtttccctggttaaatgctatcaagtatcggcccacatctgtcaag
ctgttgaaaactacagtgccaattgtctcgaagaagaggcaaaagtag

DBGET integrated database retrieval system