KEGG   Saccharomyces cerevisiae (budding yeast): YAL035W
Entry
YAL035W           CDS       T00005                                 

Gene name
FUN12, yIF2
Definition
(RefSeq) translation initiation factor eIF5B
  KO
K03243  translation initiation factor 5B
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YAL035W (FUN12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:sce03012]
    YAL035W (FUN12)
Translation factors [BR:sce03012]
 Eukaryotic type
  Initiation factors
   eIF-5
    YAL035W (FUN12)
SSDB
Motif
Pfam: GTP_EFTU IF-2 GTP_EFTU_D2 MMR_HSR1 GTP_EFTU_D4 Roc
Other DBs
NCBI-GeneID: 851196
NCBI-ProteinID: NP_009365
SGD: S000000033
UniProt: P39730
Structure
PDB: 
4N3S 3WBI 3WBJ 4NCF 3WBK

Position
I:76427..79435
AA seq 1002 aa
MAKKSKKNQQNYWDEEFEEDAAQNEEISATPTPNPESSAGADDTSREASASAEGAEAIEG
DFMSTLKQSKKKQEKKVIEEKKDGKPILKSKKEKEKEKKEKEKQKKKEQAARKKAQQQAQ
KEKNKELNKQNVEKAAAEKAAAEKSQKSKGESDKPSASAKKPAKKVPAGLAALRRQLELK
KQLEEQEKLEREEEERLEKEEEERLANEEKMKEEAKAAKKEKEKAKREKRKAEGKLLTRK
QKEEKKLLERRRAALLSSGNVKVAGLAKKDGEENKPKKVVYSKKKKRTTQENASEAIKSD
SKKDSEVVPDDELKESEDVLIDDWENLALGDDDEEGTNEETQESTASHENEDQNQGEEEE
EGEEEEEEEEERAHVHEVAKSTPAATPAATPTPSSASPNKKDLRSPICCILGHVDTGKTK
LLDKIRQTNVQGGEAGGITQQIGATYFPIDAIKAKTKVMAEYEKQTFDVPGLLVIDTPGH
ESFSNLRSRGSSLCNIAILVIDIMHGLEQQTIESIKLLRDRKAPFVVALNKIDRLYDWKA
IPNNSFRDSFAKQSRAVQEEFQSRYSKIQLELAEQGLNSELYFQNKNMSKYVSIVPTSAV
TGEGVPDLLWLLLELTQKRMSKQLMYLSHVEATILEVKVVEGFGTTIDVILSNGYLREGD
RIVLCGMNGPIVTNIRALLTPQPLRELRLKSEYVHHKEVKAALGVKIAANDLEKAVSGSR
LLVVGPEDDEDELMDDVMDDLTGLLDSVDTTGKGVVVQASTLGSLEALLDFLKDMKIPVM
SIGLGPVYKRDVMKASTMLEKAPEYAVMLCFDVKVDKEAEQYAEQEGIKIFNADVIYHLF
DSFTAYQEKLLEERRKDFLDYAIFPCVLQTLQIINKRGPMIIGVDVLEGTLRVGTPICAV
KTDPTTKERQTLILGKVISLEINHQPVQEVKKGQTAAGVAVRLEDPSGQQPIWGRHVDEN
DTLYSLVSRRSIDTLKDKAFRDQVARSDWLLLKKLKVVFGIE
NT seq 3009 nt   +upstreamnt  +downstreamnt
atggcgaaaaagagtaaaaagaaccaacagaactactgggatgaggaattcgaagaagac
gccgcccagaacgaagaaatcagtgccacgccaactccaaatccagaaagcagcgcaggt
gcagatgacacttccagagaagcaagtgcaagtgctgaaggtgctgaggccattgaaggc
gacttcatgtctactttgaagcaatcgaagaagaagcaagaaaagaaggttattgaagag
aagaaggatggtaagcctatactaaagtccaagaaggaaaaggagaaggaaaaaaaggaa
aaggagaagcagaagaagaaagaacaagctgccaggaagaaggcccaacagcaagctcaa
aaggagaagaacaaggagttgaacaagcaaaatgttgaaaaagctgctgctgagaaggct
gctgctgagaaatcccaaaaatctaaaggtgaaagtgataaaccaagtgctagtgctaag
aagccagccaagaaagtacctgccggtttggctgctttgagacgtcaattagaattgaag
aaacaacttgaagaacaagaaaagttggaaagagaggaagaagaaagattggagaaagaa
gaggaggaaagattggccaacgaagaaaaaatgaaggaagaagctaaagcagctaaaaag
gaaaaggagaaggcaaagcgtgaaaaacgaaaggctgaaggtaagctattgaccagaaag
caaaaagaagaaaagaaattattggaaagaagacgtgccgctttattgtcttccggtaac
gtcaaagttgccggtctggccaagaaggatggagaagaaaacaaaccaaagaaggttgtt
tacagcaagaagaagaagagaacaacccaggaaaacgcctccgaagccattaaatctgac
tctaagaaagactcggaagttgtacctgatgacgaactcaaagaatccgaagatgttttg
attgatgattgggaaaatttggctcttggtgatgatgacgaggagggaaccaacgaagaa
acgcaagaatccaccgcaagccatgaaaatgaagaccaaaatcaaggcgaagaagaagaa
gaaggagaagaagaagaagaagaagaagaagaaagagcacatgtgcatgaagttgccaaa
agcacaccagcagctacaccagcagctactccaactccatccagcgcttctccaaacaaa
aaagatcttcgttccccaatttgttgtattttgggtcatgtcgataccggtaagactaaa
ttgttagacaaaatcagacaaaccaacgttcaaggtggtgaagctggtggcatcacccaa
cagattggtgccacttatttccccatcgacgctattaaggcaaaaactaaagttatggct
gaatatgaaaaacaaacttttgatgtcccaggtcttttggttattgataccccaggtcac
gaatccttctctaacttacgttcaagaggttcttcattgtgtaacatcgcaattttggtt
attgacattatgcatggtttggaacaacagactattgaatctatcaaactgttaagagat
agaaaggctccatttgtcgttgccctaaacaaaattgatagattatatgactggaaagcc
attccaaacaattcattcagagactcctttgcaaagcaatcaagagctgttcaagaggaa
tttcaatctaggtattctaagattcaattggaattagctgaacaaggtttgaattcggaa
ttgtatttccaaaacaaaaatatgtctaagtatgtctccattgtcccaacatctgccgtc
accggtgagggtgttccagatttattgtggttgctattagaattgacccaaaagaggatg
tccaaacaattgatgtacttgtctcacgtggaagcaaccattttggaagtgaaagtcgta
gaaggttttggtaccacaattgatgttatcttgtccaacggttacttgagagaaggtgac
cgtattgtactgtgtggtatgaatggtccaattgtaacgaatatcagagcattactaaca
ccacaaccattacgtgaactacgtttgaaatctgaatatgtccaccacaaagaagtcaag
gctgctttaggtgtcaagattgccgctaatgatttagaaaaagccgtttctggttctagg
ctgctagttgtcggtcctgaagatgacgaagatgaattgatggacgacgttatggatgat
ttgactggtttgttggactccgttgacacaactggtaaaggtgttgtggtccaagcatcc
accttgggttctttggaagctttgttggatttcttgaaagacatgaaaatccctgtgatg
tctatcgggttaggtccagtgtacaagcgtgatgttatgaaagcctccactatgttggaa
aaggctccagagtatgccgtgatgttatgttttgatgttaaagtggataaggaagctgaa
caatacgctgaacaagaaggaattaagatctttaatgcagacgtcatctatcatttattt
gattcatttacagcataccaagaaaagttattggaagaacgtcgtaaagatttcctagat
tacgctattttcccatgtgtcttacaaaccttacaaattattaacaaacgtggtccaatg
attattggtgtagacgttctggaaggtactctacgtgtgggaactcctatttgcgctgtg
aaaaccgaccctactacaaaggaaagacaaactttgatattaggtaaagtcatctcttta
gaaatcaaccatcaacctgtccaagaagtaaagaagggccaaaccgctgctggtgttgcc
gtccgtctagaagatccctccggtcaacaacctatctggggtcgtcatgttgacgagaat
gatacattatactccttggtttcaagaagatctattgacactttgaaggataaagctttt
agggaccaagttgctagatccgattggctgctattgaagaagctgaaggtcgttttcggc
atcgaatga

DBGET integrated database retrieval system