KEGG   Saccharomyces cerevisiae (budding yeast): YBL079W
Entry
YBL079W           CDS       T00005                                 

Gene name
NUP170, NLE3
Definition
(RefSeq) Nup170p
  KO
K14312  nuclear pore complex protein Nup155
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YBL079W (NUP170)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YBL079W (NUP170)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     YBL079W (NUP170)
SSDB
Motif
Pfam: Nucleoporin_N Nucleoporin_C
Other DBs
NCBI-GeneID: 852199
NCBI-ProteinID: NP_009474
SGD: S000000175
UniProt: P38181
Structure
PDB: 
3I5Q 3I5P

Position
II:75259..79767
AA seq 1502 aa
MFQSFFHNNGPAAAGETFSDSRSYPLTNHQEVPRNGLNELASSATKAQQQPTHILNSYPI
TGSNPLMRASAMGATSGSINPNMSNMNEHIRVSGMGTSKPLDLAGKYIDHLQHKDSNTPV
LDERSYYNSGVDYNFSREKNGLGAFTPFEKQDVFNIPDEILHEFSTSQTKTDMGIFPELN
RCWITIDNKLILWNINNDNEYQVVDDMKHTIQKVALVRPKPNTFVPAVKHLLLISTTMEL
FMFAISLDKATNELSVFNTHLSVPVQGIDVIDIVSHERSGRIFFAGQASGLNIWELHYSG
SDDWFNSKCSKVCLTKSALLSLLPTNMLSQIPGVDFIQALFEDNSNGNGGFSQETITQLT
IDQQRGIIYSLSSKSTIRAYVITEKSLEGPMSIEPAYISRIIGTTTARAAPILGPKYLKI
VKISSVAPEENNNLFLVALTVGGVRLYFNGSMGRFNIEALRLESIKFPPSSVTPEVIQQE
LLHQQQEQAKRSFPFFSNLMSSEPVLLKFQKKSSVLLETTKASTIISPGIFFSAVIKSSQ
QTHQQEKKENSSVTGTTATAGSKTVKQQPVTLQHKLFVSVPDYGILKTHGKYVENATFLE
TAGPVQQIIPLSGLFNATTKPQGFANEFATQYTSETLRVAVLTSTSIEIYKYRTPDEIFE
DLIDNPLPFVLNYGAAEACSTALFVTCKSNKSEKLRSNALTFLTMGIPGVVDIKPVYNRY
SVSTVSSLLSKPTLSTATTNLQQSITGFSKPSPANKEDFDLDDVILSPRFYGIALLITRL
LRDIWGRHVFMTFTDNRVTSHAFISSSDPITPSINNLKSDEISQNRNIISKVSISKDCIE
YYLSSINILNEFFITYGDSISQISAPYVLANNSNGRVIDKTEEVANQAESIAINAMIKMV
QSIKEGLSFLNVLYEESEVEGFDNQYLGFKDIISFVSLDVQKDLVKLDFKDLFAPNDKTK
SLIREILLSIINRNITKGASIEYTATALQERCGSFCSASDILGFRAIEHLRRAKEIGLRN
YDSLNYHLKNATALLEQIVDDLSIEKLKEAVSMMLSVNYYPKSIEFLLNIANSMDKGKLA
CQYVANGFLENDDRKQYYDKRILVYDLVFDTLIKVDELAEKKQSSKTQNQISISNDDEVK
LRQKSYEAALKYNDRLFHYHMYDWLVSQNREEKLLDIETPFILPYLMEKAGSSLKISNIL
WVYYSRRSKFFESAEILYRLATSNFDITLFERIEFLSRANGFCNSVSPLSQKQRIVQLAS
RIQDACEVAGIQGDILSLVYTDARIDSAIKDELIKTLDGKILSTSELFNDFAVPLSYHEI
ALFIFKIADFRDHEVIMAKWDELFQSLRMEFNNTGKKEDSMNFINLLSNVLIKIGKNVQD
SEFIFPIFELFPIVCNFFYETLPKEHIVSGSIVSIFITAGVSFNKMYYILKELIETSDSD
NSVFNKEMTWLIHEWYKSDRKFRDIISYNDIIHLKEYKIDNDPIEKYVKNSGNNLGICFY
KE
NT seq 4509 nt   +upstreamnt  +downstreamnt
atgtttcaaagttttttccacaacaatgggcccgctgctgccggtgaaacgttttcagat
agcagatcgtaccctttaacgaatcatcaagaagtacccaggaatggactgaatgagttg
gcctcatctgcaaccaaggcgcaacaacaacctacacacatattaaactcatatccaatt
accgggtccaacccactcatgagggcaagcgcaatgggggcgacctctggcagcatcaat
cctaatatgtccaacatgaatgagcacattcgtgtttccgggatggggacttctaagccc
ctggacttagcgggaaagtacattgaccatctacaacataaagatagtaacactcccgta
ctcgacgaacgatcttattataacagcggggtagattataacttcagcagagaaaaaaac
ggcttaggagcgtttactccatttgaaaagcaagatgtgttcaacattccggacgagatt
ttgcatgaattttccacttcacagacaaaaactgatatgggtattttcccggagttaaat
cgatgttggataactattgataataaactgatactctggaatattaacaatgacaatgag
tatcaggtggtagatgatatgaagcataccattcaaaaagtcgccttggtaagacctaag
ccaaacacctttgtgcctgccgtgaagcatctacttttgataagcacgacaatggagctt
ttcatgtttgctatttccttagacaaagccaccaacgaactcagtgtattcaatacacat
ctatcagtccctgtacaaggcattgatgtaatagacattgtgtctcatgaaagatcgggt
agaattttcttcgcaggccaagccagtggcctgaatatctgggagttgcactactcaggt
tccgatgactggttcaatagtaaatgtagtaaggtctgtctgacaaagtctgccctatta
agtcttctacctactaacatgttatcgcagattccaggtgttgattttattcaggctttg
ttcgaagataattctaacggtaatggcggattttctcaagagaccatcacgcaactaact
attgaccaacaaagaggaatcatctattcattatcctccaaatccaccattagagcatac
gtaataacagaaaaatcactggaaggacccatgtcaattgagcctgcctacatcagtagg
atcataggtaccacgacggcaagggcagcaccgattttgggccccaaatacctaaaaatt
gtcaagataagctctgttgcaccagaagaaaacaacaatttgtttttagttgctttaaca
gtaggtggtgtgcgtttgtactttaatggttccatgggcagatttaacatcgaagctttg
aggttagaatcgatcaagttcccccctagttctgtaactcctgaagtcatccaacaagaa
ttactacatcaacaacaggaacaggcgaagagaagctttcctttcttttcaaatctaatg
tcttccgaaccagtcctcttaaaattccaaaagaaatcatctgtattactagagactaca
aaagcaagtacaattatttccccaggcatatttttttccgctgtgatcaagtcatctcag
caaactcatcaacaagaaaaaaaagagaactcatctgttactggaacgaccgctaccgca
gggtctaaaactgtcaaacaacagccagttactttacaacataagcttttcgttagtgtt
ccagattatggtatcttgaaaacacacggtaagtacgttgaaaatgccacgtttttggaa
actgcgggcccagttcaacaaattattcccttatcggggttgtttaatgcaacgacaaag
ccacaaggatttgctaacgaatttgcgacacagtacacatcagaaactttaagggtagca
gttttgacgagcacttctatcgaaatttataaatatcgtactcctgatgaaatttttgag
gatctaatcgataatccgctgccattcgtcttaaattatggtgccgcggaagcttgttcc
actgcattgtttgttacttgcaaatcaaataaatctgaaaaattaagatctaatgccctg
acttttttaactatgggtattcctggcgttgttgacatcaaacctgtctacaaccgttat
tctgtatctacagtatcctctttattgtcaaagcccactttatcaaccgcaacaactaat
ctccaacaatcaataactggctttagtaaaccctcccctgcaaacaaggaagattttgac
ttagatgacgtaatattatcccccagattttacggtattgcattattgattaccagacta
cttcgagatatttgggggagacatgtcttcatgacttttacagataatagggtgacatcc
catgctttcatttcttcttctgatccaatcactccatctattaataacctaaaaagtgat
gaaatttcacaaaataggaacataatatcaaaggtttctatttccaaggattgtatcgag
tactatctatcttcaattaacattttaaatgaatttttcatcacttatggtgattcaatt
tcccaaatatcagctccctacgtattagcgaacaattctaacggcagggttattgataaa
acagaagaagttgcaaaccaagcggaaagtatagcgattaatgcgatgatcaaaatggta
cagtccataaaggaaggtctatcattcttgaacgttttatacgaggaaagcgaagtcgaa
ggattcgacaaccaataccttggtttcaaggatataatcagttttgtaagcttggacgtc
caaaaagatttagtcaaactagattttaaagatttatttgctccaaatgacaaaacaaaa
tcattaattagagaaattttattatccatcatcaataggaatatcaccaaaggtgcgtcg
atagagtataccgcaacagctttacaagaacgctgtggatcattctgctctgcaagtgat
atattaggatttagagccattgaacatcttagaagggctaaagaaattggcttgcgtaac
tatgattctctaaactatcacctgaaaaatgctactgctttacttgaacaaattgtggat
gatctttctatcgagaaattgaaagaagctgtatcaatgatgctgagtgtaaattattac
ccaaaatctattgaattcttattgaatattgccaactctatggacaaaggcaaactagct
tgtcaatatgtggcaaatggatttttagaaaatgatgataggaaacaatattacgacaaa
cgtatcttagtttatgacctagtttttgatactttaataaaagtagacgaacttgccgaa
aaaaaacagtcatcaaaaactcaaaaccaaatttcgatatcgaatgacgatgaagtgaaa
ctgagacaaaaaagttatgaagccgccctaaaatataacgatagattattccactatcat
atgtatgattggcttgtgtctcagaacagagaggaaaaactattagatattgaaactcca
ttcatactcccttatttaatggaaaaggcaggtagttcattgaagatatctaatatactc
tgggtctattattcaagaagatctaaatttttcgaatctgctgaaattctttaccgttta
gctacatcgaattttgacatcacattgtttgaaagaattgagtttctttcacgcgccaat
ggtttttgcaacagtgtgtcaccattaagccagaaacaaagaattgtacaattagctagt
aggatccaagatgcatgtgaagttgctggtattcaaggtgatatattgtcgctcgtgtat
acagacgcaagaatagattcagccattaaagatgagctgatcaaaactctagatggtaaa
atattgagcacaagtgagctgtttaatgattttgctgtacccttaagttaccatgaaatt
gccctattcattttcaagatagcagattttagggaccatgaagtaattatggccaagtgg
gatgagctattccaatctttgaggatggaatttaataataccggaaagaaagaagattca
atgaacttcatcaacttactgtctaatgtactgattaaaattggtaaaaatgttcaggat
tctgaattcattttccccattttcgaactctttcccattgtctgtaattttttctacgaa
acactacctaaggaacatattgtatcagggtcgatagtttctatattcataacagcgggt
gtttctttcaacaaaatgtactatattttaaaagaactaatcgagacatcagattccgat
aattccgtatttaataaagaaatgacctggttaattcacgaatggtacaaatcggacagg
aaatttagggacattatttcctacaacgatatcattcacttgaaggaatacaaaattgat
aatgatccaattgaaaagtacgttaagaacagcggcaataatttggggatttgtttctac
aaagaataa

KEGG   Saccharomyces cerevisiae (budding yeast): YER105C
Entry
YER105C           CDS       T00005                                 

Gene name
NUP157
Definition
(RefSeq) Nup157p
  KO
K14312  nuclear pore complex protein Nup155
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YER105C (NUP157)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YER105C (NUP157)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     YER105C (NUP157)
SSDB
Motif
Pfam: Nucleoporin_N Nucleoporin_C
Other DBs
NCBI-GeneID: 856842
NCBI-ProteinID: NP_011031
SGD: S000000907
UniProt: P40064
Structure
PDB: 
4MHC

Position
V:complement(367838..372013)
AA seq 1391 aa
MYSTPLKKRIDYDRETFTASASLGGNRLRNRPRDDQNNGKPNLSSRSFLSERKTRKDVLN
KYGEAGNTIESELRDVTTHVKISGLTSSEPLQLASEFVQDLSFRDRNTPILDNPDYYSKG
LDYNFSDEVGGLGAFTPFQRQQVTNIPDEVLSQVSNTEIKSDMGIFLELNYCWITSDNKL
ILWNINNSSEYHCIDEIEHTILKVKLVKPSPNTFVSSVENLLIVATLFDIYILTISFNDR
THELNIFNTGLKVNVTGFNVSNIISYERTGQIFFTGATDGVNVWELQYNCSENLFNSKSN
KICLTKSNLANLLPTKLIPSIPGGKLIQKVLEGDAGTEEETISQLEVDQSRGVLHTLSTK
SIVRSYLITSNGLVGPVLIDAAHIRRGMNALGVKNSPLLSNRAFKIAKIVSISMCENNDL
FLAVITTTGVRLYFKGSISRRSIGSLKLDSVKFPPTSISSSLEQNKSFIIGHHPLNTHDT
GPLSTQKASSTYINTTCASTIISPGIYFTCVRKRANSGELSKGITNKALLENKEEHKLYV
SAPDYGILKNYGKYVENTALLDTTDEIKEIVPLTRSFNYTSTPQGYANVFASQYSAEPLK
VAVLTSNALEIYCYRTPDEVFESLIENPLPFIHSYGLSEACSTALYLACKFNKSEHIKSS
ALAFFSAGIPGVVEIKPKSSRESGSVPPISQNLFDKSGECDGIVLSPRFYGSALLITRLF
SQIWEERVFVFKRASKTEKMDAFGISITRPQVEYYLSSISVLADFFNIHRPSFVSFVPPK
GSNAITASDAESIAMNALILLINSIKDALSLINVFYEDIDAFKSLLNTLMGAGGVYDSKT
REYFFDLKFHDLFTPNAKTKQLIKEILIEVVNANIASGTSADYIVNVLKERFGSFCHSAD
ILCYRAGEHLEAAQKFEMIDSKISRNHLDTAIDLYERCAENIELCELRRVVDIMVKLNYQ
PKTVGFLLRFADKIDKGNQAQEYVSRGCNTADPRKVFYDKRINVYTLIFEIVKSVDDYTS
IEQSPSIANISIFSPASSLKKRVYSVIMNSNNRFFHYCFYDWLVANKRQDYLLRLDSQFV
LPYLKERAEKSLEISNLLWFYLFKEEHFLEAADVLYALASSDFDLKLSERIECLARANGL
CDSSTSFDQKPALVQLSENIHELFDIASIQDDLLNLVRNETRIDEDYRKQLTLKLNGRVL
PLSDLFNDCADPLDYYEIKLRIFKVSQFKDEKVIQGEWNRLLDSMKNAPSPDVGSVGQES
FLSSISNTLIRIGKTTRDTDVVFPVHFLMNKILESFIDKSSAADGSVCSMFLLAGVSHLK
LYYILSRIIENSEGNVELAKKEMVWLIKDWYQSDSDLRGSIAPEQIKKLEKYDPNTDPVQ
DYVKDRHHGLK
NT seq 4176 nt   +upstreamnt  +downstreamnt
atgtattcaactccactaaaaaagaggattgattacgatcgcgaaacgtttacggcttcg
gcttccttaggaggaaatcgcttaaggaatcggccaagagatgaccaaaacaacggtaag
cccaacctgtcgagccgttccttcctaagcgaaagaaaaaccaggaaagatgtattaaac
aagtatggcgaggctggaaatactattgaatcagaacttcgtgacgtaactacacacgtc
aagataagcgggttgacttcctctgaaccgttgcagttggctagtgaatttgtccaggat
ttgagctttagggacagaaatacgccaatactagataatccagactattatagtaaaggt
ttggattataatttctcagatgaagtcggtggattaggtgcatttacccccttccaaaga
caacaagtgacaaatataccagatgaagttttatcacaagtttcaaataccgaaataaag
agtgatatgggtatttttctcgaactgaactattgttggataacctctgataataaattg
atcttgtggaatatcaataatagttcagaataccactgtatcgatgaaatcgagcacacc
attttaaaagtgaaactagttaagcctagcccaaacacttttgtttcttctgttgaaaat
ttattgattgtcgccactctttttgatatctatattttgacaatatcatttaatgaccgt
actcatgagttgaatatctttaacacaggattaaaagtaaatgtaactgggttcaacgtt
tctaacataataagctacgaaaggactggacaaatatttttcactggtgcgactgatggt
gtcaacgtgtgggaattacaatataactgctcggagaacctattcaatagcaagagtaac
aaaatatgtttgacaaagtcaaacttagcaaatttactacctacaaaactaatacctagc
atacccggaggaaagttgatacaaaaagtactagaaggggatgcaggtaccgaagaagaa
actatatcacagctcgaagttgaccagtcaagaggcgttttacatactctatcaacgaaa
tctattgtcagatcttacctaattactagtaacgggctagtaggaccggtcctcattgat
gctgctcatatcaggcgtggaatgaatgcattgggtgtaaaaaattcacctctactcagt
aatcgagctttcaagattgccaaaattgtttctatctctatgtgtgagaacaatgattta
ttcttagctgttataactactactggggtacgcttgtatttcaaaggttccatttctagg
agatcgattggctcattaaaattagactctgtaaagtttcctcctaccagtatatctagc
tccctcgagcaaaataaatctttcataatcggtcatcaccccttaaacacacatgataca
ggcccactttcaacacaaaaagctagttcaacttatatcaataccacttgcgctagtacg
ataatatcaccaggtatatactttacgtgcgtgaggaaaagagctaattccggagaacta
tctaaaggtattacaaataaagctttgctggaaaataaagaggaacacaaactttacgtt
agtgctccagattacggtatattaaagaattatggtaaatatgtagagaataccgcacta
ctcgatacgacagatgaaattaaagagattgttcccttaacaagatcttttaattacact
tctactccccaaggttacgccaatgtgtttgcctcacaatacagtgcagaaccattaaaa
gttgccgttttaacaagcaatgccttagaaatttattgctatcgcacgcccgacgaagtg
ttcgaaagcttgattgaaaatcctttgccatttattcacagttatggtttatctgaggct
tgctctacggcactttatttagcttgtaagtttaataagtcagagcatattaaatcaagt
gccctggccttcttctctgccggtatacctggggtagttgaaataaaaccgaaaagttct
agagaaagtggcagcgtgccgccaatctcacaaaatttattcgataaatctggtgaatgt
gatggtatagtactatctcccaggttttatggttctgcgttattaattacaagattattt
agccaaatatgggaagagagggtctttgtttttaaaagggcttccaaaacggaaaaaatg
gatgcttttggtatttctataactaggccacaggttgagtattatttatcatcgatatct
gttttggcagatttcttcaacatccaccgtccttccttcgtttcatttgtgcctccgaaa
ggtagcaatgctataactgcatccgatgctgagtctattgctatgaatgctcttatcctc
ttaataaattctattaaggatgcgctttcccttataaatgtcttctacgaagatattgat
gctttcaaatctttgctaaatacattgatgggtgcagggggagtttatgactccaagaca
cgtgagtatttttttgatcttaagttccatgatttgtttacccctaacgcaaaaaccaaa
caattaataaaagagattttaatagaagttgtaaacgctaatattgcaagcggcacatcg
gcagattatattgtgaacgttttaaaggaacgctttggatctttttgtcatagtgcagac
attttgtgttacagggcaggagagcatttagaagcagcacagaagtttgaaatgatagat
tctaaaatatcaaggaaccatttagataccgcaattgacctttatgaaaggtgtgccgag
aatatagaattatgtgaattgagacgtgtggtggatatcatggtaaaacttaattaccag
cctaagactgttggatttctacttagatttgcagataaaattgataaaggaaaccaagca
caagagtatgtgtctagaggttgtaatactgccgatccaagaaaagttttttatgacaaa
cgcataaatgtgtacactttgatttttgagattgtcaaaagcgtggatgactatacatct
atcgaacaatccccttcaattgcaaatatatctattttttcaccagcttcgtcactgaag
aaaagagtttactcagtgataatgaatagcaataacaggttcttccattattgcttttat
gattggcttgtcgcaaataaaagacaagactacttattacgtttggattctcaatttgtt
ttgccgtacttgaaagaaagagcagaaaaatctctagaaattagtaatctgttgtggttc
tacttattcaaagaagaacattttcttgaagcagctgatgttttatatgctctagctagt
tctgattttgacttaaaattaagtgaaagaatcgaatgcctagcaagagcaaacggtctt
tgtgatagctcaacgtcattcgaccaaaagccggcactggtccagttatctgagaacatc
cacgaacttttcgacatagcttccattcaggatgacctacttaatttggtaaggaatgaa
acaaggattgacgaagattatagaaagcaactaacacttaaactaaatggaagggtgctc
ccattatcagatctctttaatgattgtgcagacccattagattactacgaaataaaacta
agaattttcaaagtatctcaattcaaagatgaaaaagtcattcaaggagagtggaatcga
ttgctcgatagcatgaaaaatgctccatcgcctgacgtgggaagtgtaggccaagaatcc
tttctttcctcgatatccaacacactaattcgaattggtaaaacaacacgcgatacggac
gttgttttccctgtacatttcttaatgaataaaatattagaatcattcattgataaaagt
tcagctgctgatggatctgtatgttcaatgttcttgcttgccggagtttctcatttaaaa
ctctattacattctaagtcgtatcatagaaaactctgaaggaaatgtcgaattggcaaaa
aaagaaatggtatggttgatcaaagattggtaccaaagtgattcagatttacgcggttca
attgcgccagaacaaatcaaaaaattggagaaatatgatccgaataccgatcccgttcaa
gattatgtgaaggatcgtcatcatggcctgaaatga

DBGET integrated database retrieval system