KEGG   Saccharomyces cerevisiae (budding yeast): YBR133C
Entry
YBR133C           CDS       T00005                                 

Gene name
HSL7
Definition
(RefSeq) protein arginine N-methyltransferase
  KO
K02516  type II protein arginine methyltransferase [EC:2.1.1.320]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
sce04011  MAPK signaling pathway - yeast
sce04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YBR133C (HSL7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    YBR133C (HSL7)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YBR133C (HSL7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:sce03041]
    YBR133C (HSL7)
   03036 Chromosome and associated proteins [BR:sce03036]
    YBR133C (HSL7)
Enzymes [BR:sce01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.320  type II protein arginine methyltransferase
     YBR133C (HSL7)
Spliceosome [BR:sce03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    YBR133C (HSL7)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    PRMTs (protein arginine metyltransferases)
     YBR133C (HSL7)
SSDB
Motif
Pfam: PRMT5_TIM PRMT5_C PRMT5
Other DBs
NCBI-GeneID: 852431
NCBI-ProteinID: NP_009691
SGD: S000000337
UniProt: P38274
Position
II:complement(501804..504287)
AA seq 827 aa
MHSNVFVGVKPGFNHKQHSKKSRFLENVSSHSPELPSNYDYVLLPITTPRYKEIVGQVFK
DFQRQSIQNWKPLQIPEPQLQDICIPPFNVKKLDNDDTPSYIGLLSSWLELESRDPNVRD
LGLKVLLNECKYARFVGINKLILAPPRDLSNLQLYGQMIYRLLQNRIVFAAPALTISISL
PLYEDSDPLATWELWNTVRKQCEYHPSLTISLALPRTRTPSYVLNRWLAEPVSCLLVSSS
IFASNQYDYPVLHKFNQNLILKFQKVNGDSQILGNELCVILHGMEKYANNVKGGESAYLE
YINYLLKKGDKVLNSNSNHQFLLQEDSRIMPPLKPHSDNLLNSTYLTFEKDLVKYDLYES
AILEALQDLAPRASAKRPLVILVAGAGRGPLVDRTFKIISMLFMDSKVSIIAIEKNPQAY
LYLQKRNFDCWDNRVKLIKEDMTKWQINEPSEKRIQIDLCISELLGSFGCNELSPECLWS
IEKYHSHNDTIFIPRSYSSYIAPISSPLFYQKLSQTNRSLEAPWIVHRVPYCILSSRVNE
VWRFEHPMAQKDTVQDEDDFTVEFSQSSLNEFKIKHRGEIHGFIGFFSANLYNNIFLSTL
PNDSTVRLKFSEETLMNTRREENLIKKCDHTPNMTSWSPIIFPLKQPISFIDDSELSVLM
SRIHSDTEQKVWYEWSLESFIYLMLSNYTSAVTAASMTIPRSIVTDDTKTLAHNRHYSAT
TNQKLDNQIDLDQDIENEEEQGFLSNLETGWQSVQDIHGLSETAKPDHLDSINKPMFDLK
STKALEPSNELPRHEDLEEDVPEVHVRVKTSVSTLHNVCGRAFSLPL
NT seq 2484 nt   +upstreamnt  +downstreamnt
atgcatagcaacgtatttgttggtgtcaaaccaggctttaatcataaacagcacagcaaa
aagtcacgtttcctagaaaatgtctctagtcattcaccagaactgcctagtaactatgat
tacgttttgcttcctataacaacgccaagatataaggaaatagttgggcaagttttcaaa
gatttccaaagacaatccatacagaactggaaaccgcttcaaattcctgaaccgcagttg
caggatatctgtatacccccgttcaacgtcaagaagctagacaatgacgatacgccgtct
tacatagggctgttatcctcttggctggagctggagagtcgcgatccaaatgtaagagat
cttggcttaaaggtccttctaaacgaatgtaagtacgcgaggtttgttggaatcaataag
ctaatattggcgcctccacgggacctgtccaacctgcaattgtatggacagatgatttac
aggctcctgcaaaatcgcatcgtctttgctgcgcctgcgttaaccatatccatttctctg
ccactttacgaagacagcgatccattggccacttgggaactgtggaataccgtgcggaaa
caatgcgaatatcatccctctttgactatctctttggctttgccaagaaccaggactcct
tcgtatgtgctgaatagatggttagccgaacccgtctcgtgtcttttggtatcttcatcc
atctttgccagtaatcagtacgattatcccgttttacacaagtttaaccagaatttgatt
ttaaagttccaaaaggttaatggagattcacaaattttgggtaatgaattatgcgtgata
ttgcatgggatggagaaatatgccaataatgttaagggcggagaatctgcctatttggaa
tatataaactacttattgaaaaagggcgacaaagtattaaattccaatagtaatcaccaa
tttttgctccaagaggactctcggataatgccgcctctgaaacctcattcagataattta
ttaaattccacatatttgacttttgaaaaagatttggtgaagtacgatctttacgaatct
gccatattagaggcgcttcaagatcttgctcctcgagcgagtgccaagagaccgttggtg
atcctagtagccggtgcgggaagaggacctttagtggatcgaacttttaagataatatca
atgttgtttatggatagtaaggtttctataattgccattgaaaaaaatccacaggcatat
ctgtacttgcaaaaaagaaatttcgactgttgggataatagagtgaaattaatcaaggag
gatatgaccaaatggcaaatcaacgagccgtcggaaaagcgtattcagatagatctgtgc
ataagtgaactgctgggttcgttcggttgcaatgaattatcaccagaatgtctctggtct
attgaaaaatatcattcccacaatgacacaattttcataccgaggtcatactcttcatac
atagcacccatttcgtcaccattattctaccaaaaactctcacaaacaaatcgctctttg
gaggcgccctggatagtccatagagtgccatactgtatattatcctcaagggtaaatgaa
gtgtggcggttcgagcatcccatggcccaaaaagatactgtccaagacgaagatgatttt
acagttgaattttctcaaagttcattaaatgagttcaagataaagcaccgcggcgaaatc
catggctttatcggattcttctcggcaaacttatataacaatatattcttgtcaactttg
cccaatgacagcacagtccgtttaaaatttagcgaagaaacgttgatgaataccagacga
gaagaaaatctaatcaagaaatgtgaccatacaccaaatatgacctcgtggtctccaatt
atctttcctttgaagcaaccaatatcctttatagatgactccgaactttctgtgctgatg
tctcggatacactccgatacagaacaaaaagtttggtatgaatggtctttggagagtttc
atataccttatgttgtcaaattacacttcggcggtaactgctgcaagcatgactattccg
aggtctatagttacagatgacactaaaactttagcccataatcgacattattcagcgact
accaatcaaaagctagataatcaaattgatcttgaccaagacattgaaaacgaagaagaa
cagggattcctatccaatctagaaactggttggcaaagcgtacaagatattcacggactc
agcgaaaccgccaaaccggaccatttagattctatcaataagcctatgtttgatctcaaa
tctactaaagcgcttgaaccctctaacgaattgccaaggcacgaagacctcgaggaagat
gttccagaagttcatgtcagagtcaagactagtgtttccacgctacataatgtctgtggc
agagccttttccctgcctctgtga

DBGET integrated database retrieval system