KEGG   Saccharomyces cerevisiae (budding yeast): YCL054W
Entry
YCL054W           CDS       T00005                                 
Symbol
SPB1
Name
(RefSeq) 27S pre-rRNA (guanosine2922-2'-O)-methyltransferase
  KO
K14857  AdoMet-dependent rRNA methyltransferase SPB1 [EC:2.1.1.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sce03009]
    YCL054W (SPB1)
Enzymes [BR:sce01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-
     YCL054W (SPB1)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    YCL054W (SPB1)
SSDB
Motif
Pfam: Spb1_C FtsJ DUF3381 Methyltransf_23
Other DBs
NCBI-GeneID: 850304
NCBI-ProteinID: NP_009877
SGD: S000000559
UniProt: P25582
Structure
Position
III:31449..33974
AA seq 841 aa
MGKTQKKNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKYGHFLEKSKVVIDLCAAPGSW
CQVASKLCPVNSLIIGVDIVPMKPMPNVITFQSDITTEDCRSKLRGYMKTWKADTVLHDG
APNVGLGWVQDAFTQSQLTLQALKLAVENLVVNGTFVTKIFRSKDYNKLIWVFQQLFEKV
EATKPPASRNVSAEIFVVCKGFKAPKRLDPRLLDPKEVFEELPDGQQNMESKIYNPEKKV
RKRQGYEEGDNLLYHETSILDFVRTEDPISMLGEMNKFTIDENDHEWKILKKLKQTTDEF
RSCIEDLKVLGKKDFKMILRWRKIAREILGIEVKDDAKTEIEVVPLTEEEQIEKDLQGLQ
EKQRLNVKRERRRKNEMKQKELQRMQMNMITPTDIGIEAASLGKESLFNLKTAEKTGILN
DLAKGKKRMIFTDDELAKDNDIYIDENIMIKDKDSAADADDLESELNAMYSDYKTRRSER
DAKFRAKQARGGDNEEEWTGFNEGSLEKKEEEGKDYIEDNDDEGVEGDSDDDEAITNLIS
KLKGQEGDHKLSSKARMIFNDPIFNNVEPDLPVNTVNDGIMSSESVGDISKLNKKRKHEE
MHQKQDEADSSDESSSDDSDFEIVANDNASEEFDSDYDSEEEKNQTKKEKHSRDIDIATV
EAMTLAHQLALGQKNKHDLVDEGFNRYTFRDTENLPDWFLEDEKEHSKINKPITKEAAMA
IKEKIKAMNARPIKKVAEAKARKRMRAVARLEKIKKKAGLINDDSDKTEKDKAEEISRLM
RKVTKKPKTKPKVTLVVASGRNKGLAGRPKGVKGKYKMVDGVMKNEQRALRRIAKKHHKK
K
NT seq 2526 nt   +upstreamnt  +downstreamnt
atgggtaagacacaaaagaagaatagtaagggacgtttagatagatactattatctagca
aaggagaaaggttatcgtgctcgttcatcctttaagattattcagattaatgaaaagtat
ggccacttcttagaaaaatcgaaggttgttattgatctgtgtgctgctcctggttcatgg
tgtcaagttgcatccaaactctgtcctgtcaactccttaattattggtgttgatattgtt
ccaatgaagccgatgcccaatgttataacttttcaaagtgatattacaacagaagattgt
agatcaaaattgaggggttatatgaagacttggaaagctgatacagtgttgcatgatggt
gctcctaatgttggtttgggttgggttcaggatgctttcacccaatctcaattaacctta
caagctttgaagttggccgtcgaaaatttggtggtgaacggtacttttgttactaaaatt
ttcagatccaaggattataataaattgatttgggttttccaacaattgtttgagaaagtt
gaagccacaaaaccacccgcatcaagaaatgtttctgcagaaatttttgtagtgtgtaaa
ggtttcaaggcaccaaagaggctggacccaagattactggatccaaaagaagtttttgaa
gaattgccagatgggcaacagaatatggagtccaagatttataatcccgaaaaaaaagtt
agaaaaagacaaggttatgaggaaggtgataatttactgtatcatgaaacctcaattttg
gattttgtcaggacggaagacccaataagcatgcttggagaaatgaataagtttacaatt
gatgagaatgaccatgaatggaagatcttgaagaaattgaaacaaaccacagacgagttc
cgttcctgtattgaagatttaaaagtcttgggtaaaaaggattttaaaatgatcctaaga
tggagaaagattgcaagggaaatcttgggcatcgaagttaaggacgacgctaaaacagaa
attgaagtagtaccgttaacagaagaggagcaaattgaaaaagatttgcaaggtttacag
gagaagcagcgtctaaatgtcaagcgcgaaagaagaaggaagaacgaaatgaagcaaaag
gaactacagagaatgcaaatgaacatgataacccccactgatattggtattgaagccgca
agtttgggtaaagaatcgttgtttaatttgaaaactgcagaaaagactggtatcttgaac
gacttggcgaagggtaagaaaagaatgatttttacagacgatgaattagccaaagataat
gatatttacattgatgaaaacatcatgatcaaagataaggattctgccgctgatgcggac
gatttagaaagcgagttgaatgccatgtatagtgattataaaactagaaggtcggaaagg
gatgccaagtttagagctaagcaagcacgtggtggcgataatgaggaagaatggaccggt
tttaatgagggaagtctagaaaagaaagaagaggaaggtaaagattatatcgaagacaat
gacgatgaaggtgtcgaaggagactccgatgatgatgaagccatcaccaatttgattagc
aaattgaagggacaagaaggtgatcacaaattgagtagtaaggcacgtatgattttcaat
gatccgatatttaataacgttgaacctgatttgccagtaaataccgtcaatgatggcata
atgagttccgagtctgttggtgatatttctaaattaaataagaaaagaaaacatgaagaa
atgcaccagaaacaagatgaagcagattcttcggatgagagttcaagtgatgactccgat
ttcgaaattgtggccaacgataatgcatcagaagaattcgattctgattatgattcagag
gaagaaaaaaatcaaacaaagaaagaaaagcattccagagacattgatattgctactgtt
gaagccatgactttggcacatcagttagcattgggtcagaaaaacaagcatgatcttgtt
gatgaaggtttcaatagatacaccttccgtgacaccgaaaatttgccagattggttttta
gaagatgaaaaggaacattcaaagataaataagccgattactaaggaggcagcgatggca
attaaagaaaaaataaaggcaatgaacgcccgtcctattaagaaggttgctgaagctaag
gcaagaaagaggatgcgtgccgtagctcggttagaaaagatcaagaagaaggcgggcttg
attaacgatgattcagacaagacagagaaggacaaggctgaagaaatttctagattgatg
cgtaaggttaccaaaaaaccaaagaccaagccaaaggttactttggttgttgcctcaggt
aggaacaaaggtttggcaggtagaccaaagggcgttaagggtaagtataagatggttgat
ggtgtcatgaagaatgaacaaagagccctaagacgtatcgcaaagaagcatcacaagaaa
aagtag

DBGET integrated database retrieval system