KEGG   Saccharomyces cerevisiae (budding yeast): YDL116W
Entry
YDL116W           CDS       T00005                                 

Gene name
NUP84
Definition
(RefSeq) Nup84p
  KO
K14301  nuclear pore complex protein Nup107
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YDL116W (NUP84)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YDL116W (NUP84)
   03036 Chromosome and associated proteins [BR:sce03036]
    YDL116W (NUP84)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     YDL116W (NUP84)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    YDL116W (NUP84)
SSDB
Motif
Pfam: Nup84_Nup100
Other DBs
NCBI-GeneID: 851441
NCBI-ProteinID: NP_010167
SGD: S000002274
UniProt: P52891
Structure
PDB: 
3IKO 3JRO 4XMM 4XMN

Position
IV:251566..253746
AA seq 726 aa
MELSPTYQTERFTKFSDTLKEFKIEQNNEQNPIDPFNIIREFRSAAGQLALDLANSGDES
NVISSKDWELEARFWHLVELLLVFRNADLDLDEMELHPYNSRGLFEKKLMQDNKQLYQIW
IVMVWLKENTYVMERPKNVPTSKWLNSITSGGLKSCDLDFPLRENTNVLDVKDKEEDHIF
FKYIYELILAGAIDEALEEAKLSDNISICMILCGIQEYLNPVIDTQIANEFNTQQGIKKH
SLWRRTVYSLSQQAGLDPYERAIYSYLSGAIPNQEVLQYSDWESDLHIHLNQILQTEIEN
YLLENNQVGTDELILPLPSHALTVQEVLNRVASRHPSESEHPIRVLMASVILDSLPSVIH
SSVEMLLDVVKGTEASNDIIDKPYLLRIVTHLAICLDIINPGSVEEVDKSKLITTYISLL
KLQGLYENIPIYATFLNESDCLEACSFILSSLEDPQVRKKQIETINFLRLPASNILRRTT
QRVFDETEQEYSPSNEISISFDVNNIDMHLIYGVEWLIEGKLYVDAVHSIIALSRRFLLN
GRVKALEQFMERNNIGEICKNYELEKIADNISKDENEDQFLEEITQYEHLIKGIREYEEW
QKSVSLLSSESNIPTLIEKLQGFSKDTFELIKTFLVDLTSSNFADSADYEILYEIRALYT
PFLLMELHKKLVEAAKLLKIPKFISEALAFTSLVANENDKIYLLFQSSGKLKEYLDLVAR
TATLSN
NT seq 2181 nt   +upstreamnt  +downstreamnt
atggaattatcccctacttatcaaacagaacgcttcacaaagttctcagacactttaaag
gaattcaaaattgaacaaaataatgagcaaaaccccattgacccgtttaacatcataaga
gagtttcgctcagccgcggggcagcttgcgttagatttggctaattctggagatgaaagt
aacgtcatatcttctaaggattgggaactggaagctagattttggcatttagtagaactg
ttactggttttcaggaacgctgatcttgatctagatgaaatggaacttcatccttataac
tcgaggggtttatttgaaaagaaattaatgcaagacaacaaacaactttatcaaatatgg
atagtgatggtttggctcaaagaaaatacatatgtgatggaaagacccaaaaatgtacca
acttcaaaatggttaaatagtattacttctggaggattgaaaagctgtgacttggatttt
cctttacgagaaaacactaatgtcctcgatgttaaagataaagaagaagatcatattttc
ttcaaatacatttacgaactaattttggccggtgcgattgatgaagcattagaagaagct
aaactttccgacaatatttcaatttgtatgatcctgtgtgggatacaagagtacttaaac
cctgtcattgatacgcaaattgcaaacgaattcaatacccagcaaggtatcaagaagcac
tctttgtggagaagaacagtttacagcctttcgcagcaggccggtttggacccttatgaa
agggcgatatacagctatttgagtggcgctattcccaaccaagaagttctgcaatattcg
gattgggagtctgatctgcacatacacttaaatcaaattttacaaactgaaattgaaaat
tatcttttggaaaacaatcaagtaggtactgatgaactgattttaccattaccttcacac
gcgctaactgtacaagaggtgcttaatagagtggcttcaaggcatccctcagaaagtgaa
catccaatcagagttttaatggcatctgtcatactagattctttgccatcagttattcat
tcatccgtggaaatgttgcttgatgtcgtcaagggaaccgaagctagtaacgatattata
gataagccttatcttctgaggatagttacacatttagccatttgccttgatataattaat
ccaggttctgttgaagaggttgataagtccaagctcattactacgtatatcagtcttctg
aaattgcaaggcctttatgaaaatattccaatatatgctactttcctgaatgagtcagac
tgcttagaggcatgctctttcatattgtcttctttagaggacccccaagtaaggaaaaag
caaattgagacaataaactttctaagattacctgcctcaaatattttgagaagaaccaca
cagcgtgttttcgatgaaaccgaacaagaatattcaccatctaacgaaatttccatatct
ttcgatgtaaacaacattgatatgcacttaatatatggcgtggaatggcttattgaaggg
aagctttatgtggacgctgtccactctatcattgccttatcgaggagatttttgttaaat
ggccgcgtaaaggctctcgaacaatttatggagagaaataatattggagaaatatgcaag
aattatgaattagagaaaatagccgataacatatcaaaggatgaaaatgaagatcagttt
ttggaagaaataactcaatatgagcatttgataaagggcataagagaatatgaagaatgg
caaaaatccgttagcttgttaagctctgaatcgaacattcctactttaatagagaaattg
caaggtttttcaaaggatacatttgaattgatcaagacatttttagtagatttaacttcc
tctaatttcgcggattcggcagattatgaaatcctgtatgagattagagccctatatact
ccatttctactgatggaattgcataaaaagttagtggaagccgcaaagttgttaaagatc
ccaaaatttatttcggaagccctggcatttacctcattggtcgctaatgagaacgacaag
atttatttattattccaatctagtggaaagttaaaagagtatctggatctcgttgctcgc
acagcaaccctttcgaactga

DBGET integrated database retrieval system