KEGG   Saccharomyces cerevisiae (budding yeast): YDL207W
Entry
YDL207W           CDS       T00005                                 

Gene name
GLE1, BRR3, NLE2, RSS1
Definition
(RefSeq) nucleoporin GLE1
  KO
K18723  nucleoporin GLE1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
sce03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YDL207W (GLE1)
   03015 mRNA surveillance pathway
    YDL207W (GLE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YDL207W (GLE1)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     YDL207W (GLE1)
SSDB
Motif
Pfam: GLE1 eIF3_subunit WDCP MMR1 MIC19_MIC25 Borrelia_P83
Other DBs
NCBI-GeneID: 851320
NCBI-ProteinID: NP_010074
SGD: S000002366
UniProt: Q12315
Structure
PDB: 
6B4E 3PEV 3PEU 3RRM 3RRN

Position
IV:88248..89864
AA seq 538 aa
MRFVFDEVFNSDTDSPEFEETCSTTSSTSSQCPTPEPSPAIKLPSFTKVGTKKLVNESVV
ILDPALENALRDLNLQSKLIPINEPIVAASSIIVPHSTNMPLPRASHSSLLDNAKNSNAT
APLLEAIEESFQRKMQNLVLANQKEIQSIRENKRRVEEQRKRKEEEERKRKEAEEKAKRE
QELLRQKKDEEERKRKEAEAKLAQQKQEEERKKIEEQNEKERQLKKEHEAKLLQQKDKLG
KAVTNFDKISKMFWHYKDKIAQIKQDIVLPIKKADVNVRNLLSRHKRKINPKFGQLTNSN
QQLFKIQNELTQLINDTKGDSLAYHWILNFIAKAVVHQAETEVRVKPESALPLGKLTLYL
LVQFPELQELFMARLVKKCPFVIGFTCEIDTEKGRQNMGWKRNNENKWEDNTSYDERMGG
ILSLFAIITRLQLPQEFITTTSHPFPIALSWHILARICNTPLNLITNTHFVILGSWWDAA
AVQFLQAYGNQASKLLILIGEELTSRMAEKKYVGAARLRILLEAWQNNNMESFPEMSP
NT seq 1617 nt   +upstreamnt  +downstreamnt
atgagatttgtgttcgatgaggttttcaattcagatactgattctccagaatttgaggaa
acatgttctacaacatcttctacgtcatcgcaatgccctacacctgagccgagcccagca
ataaagttaccttcattcacgaaagttggcacgaagaaattggtaaatgagtcggtagtt
attttagatcctgctctagaaaacgccttgcgcgatttgaaccttcaatcgaaactgatc
cccattaatgagcccattgtagccgcgtcatcgataatagtaccgcattcaaccaatatg
ccactaccgagagcatcgcattcgtcattgctagataatgctaagaactcaaatgcgaca
gcacccttactcgaggcaatagaagaatcttttcaaaggaaaatgcaaaacttggtgctt
gccaatcagaaagaaattcaatctattagagaaaataaacgtcgtgttgaagagcaacgt
aagcgaaaagaggaggaagagcgcaaacgtaaggaagctgaggaaaaggccaagcgggag
caggaattattacgtcaaaagaaggatgaagaagaacgtaaacgcaaagaagctgaagca
aagctagcgcagcagaaacaagaagaagaaaggaagaaaatagaagaacagaatgaaaag
gaaagacaattgaaaaaagaacatgaagccaaattattgcagcagaaggataaattgggt
aaagcagttacaaactttgataaaatctccaaaatgttttggcattataaagacaaaatt
gctcaaataaagcaagacatagttctgcctataaaaaaagctgatgtgaatgtaaggaat
ttgctctcacgtcataaaaggaaaattaacccgaaattcggacaattaactaatagcaac
cagcaactttttaaaatacagaatgaactaactcaattgataaatgatactaaaggcgac
tctctagcatatcattggattttaaactttattgccaaagccgtagtacatcaggcggaa
acagaagtcagggtaaaaccagagtctgctctgcccctagggaaattgactttatatttg
ttagtccaattcccagagttacaggaattgtttatggcaagacttgtcaagaaatgcccc
tttgtgataggattcacgtgtgagattgacacagaaaaaggccgtcaaaacatgggatgg
aaaagaaacaacgagaataaatgggaagataacacatcctacgatgagagaatgggcggg
atcttatcattatttgccataataacgagattacagttacctcaagaatttatcaccacc
acgagtcatcctttccccatcgcattatcgtggcatattttggctagaatatgtaatacg
ccactaaatttaataacaaatacccattttgtcatactcggttcgtggtgggatgccgct
gccgtacagtttcttcaggcgtatgggaaccaagcctctaaattgctaatcttgattggt
gaggaattgacctccagaatggctgaaaagaaatatgtgggtgctgcgagattaagaatt
ttattagaggcctggcaaaataataatatggagtcctttccggaaatgtctccttag

DBGET integrated database retrieval system