KEGG   Saccharomyces cerevisiae (budding yeast): YDR021W
Entry
YDR021W           CDS       T00005                                 

Gene name
FAL1
Definition
(RefSeq) ATP-dependent RNA helicase FAL1
  KO
K13025  ATP-dependent RNA helicase [EC:3.6.4.13]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
sce03015  mRNA surveillance pathway
sce03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    YDR021W (FAL1)
  09122 Translation
   03013 RNA transport
    YDR021W (FAL1)
   03015 mRNA surveillance pathway
    YDR021W (FAL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YDR021W (FAL1)
   03041 Spliceosome [BR:sce03041]
    YDR021W (FAL1)
   03009 Ribosome biogenesis [BR:sce03009]
    YDR021W (FAL1)
   03012 Translation factors [BR:sce03012]
    YDR021W (FAL1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     YDR021W (FAL1)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     YDR021W (FAL1)
   mRNA cycle factors
    Stress granule specific factors
     YDR021W (FAL1)
Spliceosome [BR:sce03041]
 Complex C
  Other components
   EJC/TREX
    YDR021W (FAL1)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic type
  90S particles
   Helicases
    YDR021W (FAL1)
Translation factors [BR:sce03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    YDR021W (FAL1)
SSDB
Motif
Pfam: DEAD Helicase_C AAA_30 ResIII AAA_19 Helicase_RecD AAA_22 PhoH CMS1 TniB CobA_CobO_BtuR Flavi_DEAD
Other DBs
NCBI-GeneID: 851584
NCBI-ProteinID: NP_010304
SGD: S000002428
UniProt: Q12099
Position
IV:486804..488003
AA seq 399 aa
MSFDREEDQKLKFKTSKKLKVSSTFESMNLKDDLLRGIYSYGFEAPSSIQSRAITQIISG
KDVIAQAQSGTGKTATFTIGLLQAIDLRKKDLQALILSPTRELASQIGQVVKNLGDYMNV
NAFAITGGKTLKDDLKKMQKHGCQAVSGTPGRVLDMIKKQMLQTRNVQMLVLDEADELLS
ETLGFKQQIYDIFAKLPKNCQVVVVSATMNKDILEVTRKFMNDPVKILVKRDEISLEGIK
QYVVNVDKEEWKFDTLCDIYDSLTITQCVIFCNTKKKVDWLSQRLIQSNFAVVSMHGDMK
QEERDKVMNDFRTGHSRVLISTDVWARGIDVQQVSLVINYDLPEIIENYIHRIGRSGRFG
RKGVAINFITKADLAKLREIEKFYSIKINPMPANFAELS
NT seq 1200 nt   +upstreamnt  +downstreamnt
atgtcgtttgacagagaagaagaccaaaaattgaagtttaaaacatcgaaaaaattaaag
gtgtcttctacttttgaaagcatgaatctaaaagatgacttacttcgaggaatatactca
tacggttttgaagcaccatcctctatccaatcaagggctattacacagattatttcgggc
aaggacgttatagcacaagcacaatcaggtacaggtaagacagcaacttttacaatcggc
cttttacaagctattgatttaaggaagaaagatttacaagctctaatactatctccaaca
cgtgaattagcaagccaaattgggcaagtagtaaaaaatctaggggattatatgaatgtc
aatgcatttgccattacaggtggtaaaactttgaaagacgacctgaagaaaatgcaaaag
catggttgccaggccgttagcggaacaccaggaagagtattagacatgattaagaaacaa
atgttgcaaacaagaaatgttcaaatgttagttttagatgaggctgatgaattattgagt
gagacactaggtttcaagcaacaaatatacgatatttttgcaaaattgcctaaaaattgc
caagttgttgttgtcagcgcaacaatgaataaggacattttagaagtaaccagaaaattt
atgaatgatccagttaaaatcctagtgaagagggatgaaatatcacttgaaggtatcaaa
caatatgtcgttaatgttgacaaagaagagtggaaattcgatactctgtgtgatatatac
gattctttgaccattacacaatgtgtgatattctgtaacaccaagaaaaaagtagattgg
ttatctcagcggctaatccaatcaaactttgctgtagtctccatgcatggtgatatgaaa
caagaagaaagagataaagtaatgaatgattttagaacaggtcattctcgtgtactgata
tcgacggatgtttgggcgcgcggtattgatgtccaacaagtttctttagtcattaactat
gacctaccagaaataatagaaaattacatccatcgtatcggtagaagtggtcgatttggt
agaaagggtgtggctataaacttcattaccaaagctgatttagcaaaacttagagaaatt
gaaaaattctattctatcaaaataaatccgatgccagcaaattttgcagaattatcataa

DBGET integrated database retrieval system