KEGG   Saccharomyces cerevisiae (budding yeast): YDR369C
Entry
YDR369C           CDS       T00005                                 

Symbol
XRS2
Name
(RefSeq) Xrs2p
  KO
K10868  DNA repair protein XRS2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03440  Homologous recombination
sce03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    YDR369C (XRS2)
   03450 Non-homologous end-joining
    YDR369C (XRS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sce03400]
    YDR369C (XRS2)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     YDR369C (XRS2)
   NHEJ (non-homologous end-joining)
    MRX complex
     YDR369C (XRS2)
SSDB
Motif
Pfam: FHA PhoLip_ATPase_N
Other DBs
NCBI-GeneID: 851975
NCBI-ProteinID: NP_010657
SGD: S000002777
UniProt: P33301
Position
IV:complement(1215016..1217580)
AA seq 854 aa
MWVVRYQNTLEDGSISFISCCLQAFKTYSIGRSSKNPLIIKNDKSISRQHITFKWEINNS
SDLKHSSLCLVNKGKLTSLNKKFMKVGETFTINASDVLKSTIIELGTTPIRIEFEWINEV
WNIPPHLTQFRTMLSEYGISTEISINDIPANLMISDYPKSEDNSIRELYALVSTIPMKKS
RFLMELCNTLLPTSKTNLKFDEMWNDMISNPEYNVFDFDPNILLSKFMRLNNIRVLTTIK
SEPRLSSLLRTFNINLFAFDNIDSLYKYVDSLEASTEYLILTTTDKKENGKILCTIKTML
TSIIDGTLSAVINMKGASSRTLDNGKFDQISEGMSTILKTSRAPEVEASPVVSKKRKLNR
RRVLPLDSLDFFAGGLSTKTLSENRSLTDAKRLNCGAESKTVISSPNIAEADEKHAPFLQ
NALKPTEDIGKKSGHSSPGAIIVSSPNLGTVNTSEDSLDKSLQSHKLPQPSLPEVAGIGS
QTISSNSADYETAAVNSMDDAEVTKNFRVNHHQNIEQPSKNIRKLSNYSREISSPLQENC
KSPVKELSIKEKSGTPHAFVEAIQETKNREVKRVKSTIVELKDEELSEEAINQLKNLAIV
EPSNNLLRKSFDSEGNKTSRTTEKWENSLMEPEWHKRKNFKTFVKVRPKSKAHKEEGKNN
TQSSDFIRNAAFLITRNYVPLKKYSKKDTTTKWGTEENEDMFALTEMERFGSNTFMSDNI
NSNTIQKRSQALNRFTNEDSSNEGEEDSFSFSRCSGTAASVQPLKNKIFITDEDDLGDID
DKSDRLNHRENNRNLFVVKEMNLRPNLSEECSKQSRHSRSATSRSRGSFGASNNGDGDDD
DDDGPKFTFKRRKG
NT seq 2565 nt   +upstreamnt  +downstreamnt
atgtgggtagtacgataccagaatacattggaagatggctctattagctttatatcatgt
tgtcttcaggccttcaaaacttatagtataggtagatcaagtaaaaacccactgataatt
aaaaatgataaaagtatttccagacagcatatcacattcaaatgggaaatcaataatagt
tcggatctgaaacacagtagcctgtgtttagttaacaagggtaaattgacatcattaaat
aaaaaattcatgaaagttggcgaaacatttactattaatgcctcggacgttttaaagtcc
acaataattgaactgggtacaactcctattcgtatagagttcgaatggataaatgaagtc
tggaacattcctcctcatttgacacaattcaggacgatgctttctgaatatggtatctcc
actgagatttctattaatgatattcccgctaatctgatgattagcgattacccaaagagc
gaggacaacagcatacgggaattgtatgcccttgttagtactatacccatgaaaaaatca
cggtttctgatggaattgtgtaatactcttcttcccacatctaaaactaatttaaaattt
gatgaaatgtggaacgatatgattagtaatccggagtacaatgtttttgattttgatcca
aatattttgctttcgaagtttatgaggctgaataatatcagagtgttaactactatcaaa
agtgaaccacgtctatcatctctcctgcggacgttcaatataaatttatttgcatttgac
aacattgatagtttatataaatatgttgacagcttggaagcatcaacagaatacctgatt
ttgacaactacagataagaaagaaaatgggaaaattctatgtactatcaaaacgatgtta
acatcaataatagatggcaccttaagcgcagtgattaatatgaagggtgcatcttcaaga
actctagataacggtaaatttgatcaaatttctgaaggaatgtctactattttgaaaaca
tctcgtgcacctgaagttgaagctagtccagtagtctcgaagaagcgaaaattaaataga
cgtagagtactaccactcgatagtcttgatttttttgctggaggtttgagtactaagact
ctatcagaaaataggtctttaactgacgctaagagacttaattgtggcgcagaatcaaag
actgtcatttcaagtcccaacattgcagaggcagatgaaaagcacgccccatttcttcaa
aacgcactaaagccgactgaagatattggaaagaaaagtggtcacagtagccctggtgct
ataattgtcagtagccccaacttaggtactgtgaacacgagtgaggattcgttggataag
tcgctacagtcacataagttaccacagccgtcattgccggaggtagcagggattggctct
caaaccatatcttcgaactccgctgactatgaaacagctgctgtgaattcgatggatgat
gctgaagttactaagaattttagggtgaatcatcaccagaatatagagcaaccctctaaa
aacatccgtaaactttctaattattcacgagaaatttcatctccattacaagaaaattgt
aagtcacctgtaaaagagttatctattaaagagaaatctggtacgccgcacgcatttgtt
gaagctattcaagaaactaaaaatagagaggtcaaaagagttaagtcaaccattgttgaa
ttgaaggatgaggagttgagcgaggaagctattaatcagctaaaaaatttggctattgta
gaacctagtaacaatttactgaggaaatcatttgatagtgagggaaacaaaacaagcaga
acaactgaaaaatgggaaaatagcctaatggagccagaatggcataaacgcaagaatttc
aagacttttgtcaaggtacgtccaaaatcaaaggcgcacaaagaagagggtaaaaataac
actcaaagctcagattttatacgaaatgcagcctttttaatcactagaaattatgttccg
ttaaaaaaatactccaaaaaggatacaactacaaaatggggcacagaagaaaacgaagat
atgtttgctttgacggagatggaaagatttggatcgaatacatttatgtccgataatata
aactcaaacactatccagaaaagatctcaagctctaaacagattcacgaatgaggatagt
tcaaatgaaggagaagaagattcgttttctttttctcgttgttcaggtactgcagccagc
gttcaaccactaaaaaacaaaatttttattactgatgaagatgatctgggtgatattgat
gataaaagcgatagactaaatcacagagaaaataatcgtaatctttttgtggtgaaggaa
atgaacttacggccaaacttgtcagaagaatgttccaagcaaagtagacacagtagaagc
gcaactagtagatcacgtggctcttttggggcttctaataacggtgatggcgacgacgac
gatgacgacggtccgaagtttacgttcaaaagaagaaaaggataa

DBGET integrated database retrieval system