KEGG   Saccharomyces cerevisiae (budding yeast): YDR381W
Entry
YDR381W           CDS       T00005                                 

Gene name
YRA1, SHE11
Definition
(RefSeq) RNA-binding protein YRA1
  KO
K12881  THO complex subunit 4
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
sce03015  mRNA surveillance pathway
sce03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    YDR381W (YRA1)
  09122 Translation
   03013 RNA transport
    YDR381W (YRA1)
   03015 mRNA surveillance pathway
    YDR381W (YRA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YDR381W (YRA1)
   03041 Spliceosome [BR:sce03041]
    YDR381W (YRA1)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     YDR381W (YRA1)
    TREX complex
     YDR381W (YRA1)
Spliceosome [BR:sce03041]
 Complex C
  Other components
   EJC/TREX
    YDR381W (YRA1)
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   TREX complex
    YDR381W (YRA1)
SSDB
Motif
Pfam: RRM_1 FoP_duplication
Other DBs
NCBI-GeneID: 851988
NCBI-ProteinID: NP_010669
SGD: S000002789
UniProt: Q12159
Structure
PDB: 
5SUP

Position
IV:join(1236558..1236842,1237609..1238004)
AA seq 226 aa
MSANLDKSLDEIIGSNKAGSNRARVGGTRGNGPRRVGKQVGSQRRSLPNRRGPIRKNTRA
PPNAVARVAKLLDTTREVKVNVEGLPRDIKQDAVREFFASQVGGVQRVLLSYNERGQSTG
MANITFKNGELARRAVERFNGSPIDGGRSRLRLNLIVDPNQRPVKSLADRIKAMPQKGGN
APRPVKRGPNRKAAMAKSQNKPKREKPAKKSLEDLDKEMADYFEKK
NT seq 681 nt   +upstreamnt  +downstreamnt
atgtctgctaacttagataaatccttagacgaaatcattggctctaacaaagcaggaagt
aatagagcccgtgtcggtggtactcgtggtaacggtccaagaagagttggtaagcaagtt
ggtagccaacgtaggagccttccaaacagaagaggccctatcagaaaaaatactagggca
cctccaaacgcagtcgctagagttgccaagctcttggacaccactagagaggtcaaggtc
aacgtcgaaggtttgccaagggacattaagcaggatgctgtaagagaattttttgcatct
caagtaggtggtgttcaaagagttttgttgagttataacgaaaggggccaatctactggt
atggctaacatcacattcaaaaacggtgaattggccagaagggctgttgaaagatttaac
ggctctccaatcgatggaggcagatcaagattgagacttaacctaatcgttgatccaaac
caacgcccagtcaaaagtttagccgacaggatcaaggctatgccacaaaaaggcggaaac
gctccaagaccagtaaagaggggtccaaatagaaaagctgctatggcaaaatcccaaaac
aaaccaaagagagaaaagcctgctaagaaaagtcttgaagatctggacaaggaaatggcg
gactatttcgaaaagaaataa

DBGET integrated database retrieval system