KEGG   Saccharomyces cerevisiae (budding yeast): YDR532C
Entry
YDR532C           CDS       T00005                                 

Gene name
KRE28
Definition
(RefSeq) Kre28p
  KO
K05749  cytoplasmic FMR1 interacting protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YDR532C (KRE28)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YDR532C (KRE28)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     YDR532C (KRE28)
   Factors involved in mRNA localization
    Other mRNA localization factors
     YDR532C (KRE28)
SSDB
Motif
Pfam: Kre28 DUF5798
Other DBs
NCBI-GeneID: 852145
NCBI-ProteinID: NP_010821
SGD: S000002940
UniProt: Q04431
Position
IV:complement(1499396..1500553)
AA seq 385 aa
MDTGSASIKDYETVLTDIEDSIAVSSEEVLNNQELRLKNTLHEITSSILAINEENKFVNP
LRNDESLDVEGKEVFVNPKILSAKIKEFNKLMELLKLTYLEQETLDYFFRFTLSSTKPLQ
LDSEKDPQFVKLNERVNDLKEEISNVQESKIEQIKAEIQETGHNFAERQDLINELYLEAT
GDIENCWDSLNELKNLTNKEDKNMMGEKDTILNSSDSDDFVEETYTNWQKLLFLQKQNQR
LTKELKEMHEVKNQIIRKGEQSKKEDSGHLMANESELCQSINLLTKFWEKHFLLKGSKTT
ILNFEIFTQLGKVQFEIKDMQYIIAISLSDLKRPMIKDITILQKAGGNIVTDIEASSKFN
NKYRNNTKVQIFEVMDDIISELTNE
NT seq 1158 nt   +upstreamnt  +downstreamnt
atggatacagggagtgcgagcataaaggactatgagaccgtgttaacggatattgaggat
tctattgctgtgagcagcgaagaagtgctaaataaccaagaactaaggctcaaaaataca
ttgcacgaaattacttccagcattctggcaataaatgaagagaacaagtttgtgaatcct
cttaggaacgatgagagcttagacgtagagggaaaggaggtctttgtaaatccaaaaatt
ctgagtgcaaaaatcaaggagttcaataaactaatggagttacttaagttgacttacttg
gaacaggagacattggactatttcttcaggtttactttgtcctcgacgaaacctttgcag
ttagattccgaaaaagacccccaatttgtaaaacttaatgaaagagttaatgatttaaag
gaagaaatttcgaatgttcaagaaagcaaaatagaacaaatcaaagctgaaatccaagag
accggtcacaactttgcagaaaggcaagatttaataaatgagttgtatctggaagccact
ggtgatattgaaaattgttgggattcgctcaatgaactaaaaaatttaacaaacaaagaa
gataagaatatgatgggagaaaaagatacgatattaaattcaagtgattcagatgatttt
gtggaagagacatacacgaattggcaaaaactactatttttgcagaagcaaaatcaaagg
ttaacgaaagagctcaaggaaatgcatgaagttaaaaatcaaataatacgaaaaggagag
caatcaaaaaaagaggattctggacatttaatggccaatgaatcagaattatgtcagtca
attaatttgctaacaaaattttgggaaaagcactttttactcaaagggtcaaagacgact
atattaaattttgaaatctttacccagcttggaaaagtacaatttgaaataaaggatatg
caatatataattgccatatctttaagcgatttaaaaaggccaatgataaaagacattact
attttacaaaaagcgggtggcaatatagtcacagacattgaagcgagcagtaaatttaac
aataagtacagaaataatactaaggtgcaaatctttgaggtaatggatgacattataagc
gagctaacaaacgaataa

DBGET integrated database retrieval system