KEGG   Saccharomyces cerevisiae (budding yeast): YER107C
Entry
YER107C           CDS       T00005                                 

Gene name
GLE2, RAE1
Definition
(RefSeq) RNA export factor GLE2
  KO
K14298  mRNA export factor
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YER107C (GLE2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YER107C (GLE2)
   03036 Chromosome and associated proteins [BR:sce03036]
    YER107C (GLE2)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     YER107C (GLE2)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    YER107C (GLE2)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 Nup160
Other DBs
NCBI-GeneID: 856844
NCBI-ProteinID: NP_011033
SGD: S000000909
UniProt: P40066
Position
V:complement(373448..374545)
AA seq 365 aa
MSFFNRSNTTSALGTSTAMANEKDLANDIVINSPAEDSISDIAFSPQQDFMFSASSWDGK
VRIWDVQNGVPQGRAQHESSSPVLCTRWSNDGTKVASGGCDNALKLYDIASGQTQQIGMH
SAPIKVLRFVQCGPSNTECIVTGSWDKTIKYWDMRQPQPVSTVMMPERVYSMDNKQSLLV
VATAERHIAIINLANPTTIFKATTSPLKWQTRCVACYNEADGYAIGSVEGRCSIRYIDDG
MQKKSGFSFKCHRQTNPNRAPGSNGQSLVYPVNSIAFHPLYGTFVTAGGDGTFNFWDKNQ
RHRLKGYPTLQASIPVCSFNRNGSVFAYALSYDWHQGHMGNRPDYPNVIRLHATTDEEVK
EKKKR
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgtctttttttaatcgatcaaatacaacctcagctttgggaacgagtactgcaatggcg
aatgaaaaggatttggccaatgatattgtcattaatagcccagcagaggactcaatatcg
gatattgcgttttcaccgcaacaagatttcatgtttagtgccagttcctgggacggtaag
gtacgtatttgggatgtccaaaatggtgtacctcaaggtagagcgcagcatgaaagctcc
agccctgtattatgtaccagatggtcgaatgatggtacaaaagtagcctcaggcgggtgt
gataatgccctgaaattgtacgatattgccagtggtcaaacacagcaaattggaatgcat
tctgcgccaataaaagtattacgttttgtacaatgtggaccatcgaacacagagtgtata
gtaaccggatcctgggataaaaccataaaatattgggatatgagacaaccccagcccgta
tccaccgtaatgatgcctgaaagagtatattcgatggataataaacagtctctgttagta
gtggctactgccgaaagacatatcgctattatcaatctagcaaacccaacaacgattttt
aaggcaaccacgtcacctttaaaatggcaaactcgatgcgtggcatgttataatgaagcc
gatggatatgcgattggttcagtggaaggtagatgctccataaggtatatcgatgatggt
atgcagaaaaaatcaggcttttcatttaaatgccatcgtcaaaccaatcctaatagggca
cctggctccaatggtcaatctctagtgtatcctgtaaatagcattgcatttcatccatta
tatggtacttttgttacggctggtggtgatggtaccttcaatttttgggataagaatcaa
aggcatagattgaaaggctatcctactttgcaagcatctattcctgtatgcagcttcaat
aggaatggtagcgtatttgcgtacgctctaagttatgattggcatcaaggccatatgggc
aacagacccgactatccaaacgtcattaggctacatgccacaactgatgaagaggttaaa
gagaaaaagaaaaggtga

DBGET integrated database retrieval system