KEGG   Saccharomyces cerevisiae (budding yeast): YFR002W
Entry
YFR002W           CDS       T00005                                 

Gene name
NIC96
Definition
(RefSeq) linker nucleoporin NIC96
  KO
K14309  nuclear pore complex protein Nup93
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YFR002W (NIC96)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YFR002W (NIC96)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     YFR002W (NIC96)
SSDB
Motif
Pfam: Nic96 HHH_4 DUF2802
Other DBs
NCBI-GeneID: 850552
NCBI-ProteinID: NP_116657
SGD: S000001898
UniProt: P34077
Structure
PDB: 
2QX5 2RFO

Position
VI:150016..152535
AA seq 839 aa
MLETLRGNKLHSGTSKGANKKLNELLESSDNLPSASSELGSIQVSINELRRRVFQLRSKN
KASKDYTKAHYLLANSGLSFEDVDAFIKDLQTNQFLEPNPPKIIESEELEFYIRTKKEEN
ILMSIEQLLNGATKDFDNFINHNLNLDWAQHKNEVMKNFGILIQDKKTVDHKKSISSLDP
KLPSWGNKGNNILNSNESRLNVNENNILREKFENYARIVFQFNNSRQANGNFDIANEFIS
ILSSANGTRNAQLLESWKILESMKSKDINIVEVGKQYLEQQFLQYTDNLYKKNMNEGLAT
NVNKIKSFIDTKLKKADKSWKISNLTVINGVPIWALIFYLLRAGLIKEALQVLVENKANI
KKVEQSFLTYFKAYASSKDHGLPVEYSTKLHTEYNQHIKSSLDGDPYRLAVYKLIGRCDL
SRKNIPAVTLSIEDWLWMHLMLIKEKDAENDPVYERYSLEDFQNIIISYGPSRFSNYYLQ
TLLLSGLYGLAIDYTYTFSEMDAVHLAIGLASLKLFKIDSSTRLTKKPKRDIRFANILAN
YTKSFRYSDPRVAVEYLVLITLNEGPTDVELCHEALRELVLETKEFTVLLGKIGRDGARI
PGVIEERQPLLHVRDEKEFLHTITEQAARRADEDGRIYDSILLYQLAEEYDIVITLVNSL
LSDTLSASDLDQPLVGPDDNSETNPVLLARRMASIYFDNAGISRQIHVKNKEICMLLLNI
SSIRELYFNKQWQETLSQMELLDLLPFSDELSARKKAQDFSNLDDNIVKNIPNLLIITLS
CISNMIHILNESKYQSSTKGQQIDSLKNVARQCMIYAGMIQYRMPRETYSTLINIDVSL
NT seq 2520 nt   +upstreamnt  +downstreamnt
atgctggagacgttgcgcggaaataagctgcattctggcacctcaaaaggcgccaacaaa
aagttgaatgaactcttggaatcgtccgacaatctaccatcagcatcctctgaattaggt
tcaattcaagtaagcattaatgaattgagaagacgtgtttttcaattgagaagcaagaac
aaagctagcaaggactatactaaagcccactatttattggctaacagtggcttaagcttt
gaagatgttgatgctttcatcaaagacttgcagacgaatcaatttttggaaccaaatcca
ccaaaaataattgaaagtgaggaattagaattctatataagaactaaaaaggaagaaaac
attttgatgtctatcgaacagcttttaaatggcgctacaaaagattttgataattttatt
aatcataacttaaatcttgattgggctcagcataaaaatgaagtcatgaaaaattttggc
atccttatacaagataagaaaactgtagatcacaaaaaatccatcagttctctagaccct
aagcttccaagctggggtaataagggcaataacattttaaatagcaacgaatccagattg
aatgtcaacgaaaataatatccttagggaaaagtttgaaaattatgccagaattgtgttt
caatttaacaatagtagacaagcaaatggaaattttgatatagccaacgaattcatctca
atattatcttctgcgaacggaacaagaaacgctcaattgctagagagctggaagattctc
gaatcgatgaaaagtaaggatattaatattgttgaagtcgggaaacagtacctggagcaa
cagtttttacaatataccgacaatttatataagaaaaacatgaatgaaggattggccaca
aatgtcaataaaatcaagtcattcattgatacgaagttgaagaaagcagacaaatcatgg
aagatttctaatttaactgttatcaatggtgttccaatatgggccttaatattttatctt
ttaagagcaggtctaatcaaggaagcattgcaagttctagtggagaataaggcgaatatc
aaaaaagtagaacaatcattccttacttatttcaaagcatatgcttcttcaaaggaccac
ggcctaccagtggaatattccaccaagcttcatacagaatacaaccaacacataaaaagt
tcactagatggtgatccttatcgtctagctgtctacaagttgatcggaagatgcgacttg
agtagaaagaacattcctgcagttactttaagcattgaagattggttgtggatgcatctc
atgttgatcaaagaaaaggacgcggagaatgatcctgtttatgaaagatattccttagaa
gacttccagaatataataatatcgtatggaccatctcgcttctcaaactattacttacag
acccttttgttaagtgggctctatggattggctattgactatacttatacatttagtgaa
atggatgcggtgcatttggcaatagggctagcaagcttgaagctatttaagattgatagc
tcaacgcgcttgaccaaaaaacccaaaagggatatcaggttcgcaaacatactagctaat
tataccaagtcctttaggtattcagatcctagagttgctgtcgaatatttggttttaata
actctaaatgaaggacctaccgatgtcgagttatgccatgaggcgttgagggagctagta
ttggaaactaaggaatttactgttcttttgggtaaaattggacgcgatggagctagaatt
ccgggggtgatcgaagaaagacaacctttattacacgttcgtgatgaaaaggagtttttg
catacaattacagaacaagcagcaagaagggcagacgaagacggcagaatatatgatagt
atattactgtaccagcttgctgaagaatatgacatagttattaccctcgtcaatagttta
ttaagtgatacacttagtgcgtcagatttagatcaaccattggttggacctgatgacaat
agcgagacgaatcctgtcttgttggctaggaggatggcgtccatatattttgataatgct
ggtatatcgagacagattcatgttaaaaacaaagaaatttgtatgctgctcttaaatatc
tcctctatcagggagctatatttcaataaacaatggcaagaaacactatcccaaatggag
ttattggatttacttcctttctcagacgagctatctgctagaaagaaagcacaagatttc
tctaatttagatgacaacattgtgaaaaatattccaaatttgttgattatcactctaagc
tgtatatcgaacatgattcatatcttgaacgaaagtaagtatcaatcgtccacaaaaggt
caacaaattgattccttaaaaaatgttgcgagacaatgtatgatttatgctggtatgatt
caatacagaatgccaagggaaacgtacagcactttaattaatatagacgtctctctatga

DBGET integrated database retrieval system