KEGG   Saccharomyces cerevisiae (budding yeast): YGL049C
Entry
YGL049C           CDS       T00005                                 

Gene name
TIF4632
Definition
(RefSeq) translation initiation factor eIF4G
  KO
K03260  translation initiation factor 4G
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YGL049C (TIF4632)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YGL049C (TIF4632)
   03012 Translation factors [BR:sce03012]
    YGL049C (TIF4632)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     YGL049C (TIF4632)
   mRNA cycle factors
    Stress granule specific factors
     YGL049C (TIF4632)
Translation factors [BR:sce03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    YGL049C (TIF4632)
SSDB
Motif
Pfam: MIF4G eIF_4G1 SUB1_ProdP9
Other DBs
NCBI-GeneID: 852833
NCBI-ProteinID: NP_011466
SGD: S000003017
UniProt: P39936
Position
VII:complement(406860..409604)
AA seq 914 aa
MTDQRGPPPPHPQQANGYKKFPPHDNQYSGANNSQPNNHYNENLYSAREPHNNKQYQSKN
GKYGTNKYNNRNNSQGNAQYYNNRFNNGYRLNNNDYNPAMLPGMQWPANYYAPQMYYIPQ
QMVPVASPPYTHQPLNTNPEPPSTPKTTKIEITTKTGERLNLKKFHEEKKASKGEEKNDG
VEQKSKSGTPFEKEATPVLPANEAVKDTLTETSNEKSTSEAENTKRLFLEQVRLRKAAME
RKKNGLISETEKKQETSNHDNTDTTKPNSVIESEPIKEAPKPTGEANEVVIDGKSGASVK
TPQHVTGSVTKSVTFNEPENESSSQDVDELVKDDDTTEISDTTGGKTVNKSDDETINSVI
TTEENTVKETEPSTSDIEMPTVSQLLETLGKAQPISDIYEFAYPENVERPDIKYKKPSVK
YTYGPTFLLQFKDKLKFRPDPAWVEAVSSKIVIPPHIARNKPKDSGRFGGDFRSPSMRGM
DHTSSSRVSSKRRSKRMGDDRRSNRGYTSRKDREKAAEKAEEQAPKEEIAPLVPSANRWI
PKSRVKKTEKKLAPDGKTELFDKEEVERKMKSLLNKLTLEMFDSISSEILDIANQSKWED
DGETLKIVIEQIFHKACDEPHWSSMYAQLCGKVVKDLDPNIKDKENEGKNGPKLVLHYLV
ARCHEEFEKGWADKLPAGEDGNPLEPEMMSDEYYIAAAAKRRGLGLVRFIGYLYCLNLLT
GKMMFECFRRLMKDLNNDPSEETLESVIELLNTVGEQFEHDKFVTPQATLEGSVLLDNLF
MLLQHIIDGGTISNRIKFKLIDVKELREIKHWNSAKKDAGPKTIQQIHQEEEQLRQKKNS
QRSNSRFNNHNQSNSNRYSSNRRNMQNTQRDSFASTKTGSFRNNQRNARKVEEVSQAPRA
NMFDALMNNDGDSD
NT seq 2745 nt   +upstreamnt  +downstreamnt
atgactgaccaaagaggtccaccgcccccacacccgcagcaagccaatggctacaagaaa
tttcctcctcatgataaccaatactctggagccaataatagtcagccaaataaccactac
aatgaaaatctttacagtgcaagggaacctcacaataacaagcaataccagtcgaaaaat
ggcaaatacgggacaaataaatacaataatcgtaataatagtcaaggaaatgcacagtac
tacaataacagattcaataatggctacagactgaataacaacgactataacccggcaatg
ttgccaggtatgcaatggccagctaactactatgctcctcagatgtattatataccccaa
caaatggttccagttgcttctccaccatatacacaccaaccactcaacactaatcccgaa
cctccctctacacctaaaactacaaaaatagaaatcactacgaaaactggtgaacgttta
aatttgaaaaaattccacgaagaaaagaaagcttcgaaaggtgaagagaagaatgatggg
gtagagcagaaatctaaatcaggaaccccttttgaaaaggaggcaactcctgtactacct
gctaatgaagcagttaaagatacgttaaccgaaacatctaatgaaaaatctacctctgaa
gcggaaaatactaagagattatttttagagcaggtgagattgcgcaaagctgccatggaa
agaaagaaaaacggtttaatctccgaaactgagaagaagcaagaaacttcaaatcatgat
aatactgatacaactaagcccaactcggttattgaatctgaacctattaaggaagcgccg
aaaccaacgggagaagctaatgaagttgtgattgatggaaaatcaggggcaagtgtcaaa
actccacaacatgtaactggaagtgtaactaaatccgtgacttttaacgaacccgagaat
gagagcagttctcaggatgttgatgagcttgttaaagatgatgatactactgaaatttcg
gatacgactggtggaaaaactgtaaataaaagtgacgacgaaacaataaattccgtaatc
accacagaggagaacacagtgaaggagacagaaccttccacttccgatattgagatgcca
actgtatctcaactacttgaaactttaggtaaggctcaaccaatttctgacatatatgag
tttgcctatccggaaaatgttgaaaggcctgatatcaaatacaagaaaccaagcgttaag
tacacttatggccctaccttcttactgcaattcaaagataaactaaaattcaggcctgat
cctgcgtgggttgaagctgtatcctcgaaaattgttatacctcctcatatagccagaaat
aaaccaaaagatagtggcagatttggaggcgatttcagaagtccatctatgcgcggtatg
gaccatacttccagttcaagagtttcatcgaaaagaagatcaaagagaatgggtgacgac
agaagatctaatagaggatatacctccagaaaagatcgcgaaaaagctgcagaaaaggca
gaagagcaagctccaaaggaagaaatcgccccgttggttccgagtgctaatagatggata
cctaaatcaagggttaaaaaaacagaaaagaagttagctcctgacggcaaaactgaatta
tttgacaaggaagaagtagaacgaaaaatgaagtctctattaaacaagttaactttagaa
atgtttgattcaatctcctctgagattttggatatagcaaaccaatcaaagtgggaagat
gatggcgaaacattgaaaatagttattgaacaaattttccacaaggcttgtgatgaacct
cattggtcttcaatgtatgctcagttatgtggcaaagtggtcaaagaccttgacccaaac
attaaagataaagagaacgaaggaaagaatggaccaaagcttgtgttgcattatttagtg
gcaagatgtcacgaagaatttgagaaaggttgggctgataagttgcctgcaggagaagat
ggtaatccactagaacctgaaatgatgtccgatgagtattatattgcggctgccgccaag
agaagagggttaggtttagtacgtttcatagggtacttatattgtttgaacttattaact
ggtaagatgatgtttgagtgcttccggagattaatgaaagatctaaacaacgatccatcc
gaggagacattagagtccgttattgaattactgaatactgtgggtgaacaatttgaacat
gataaatttgttacgcctcaggcaactcttgaaggttcggtactactcgacaatctattt
atgttgttacaacatatcattgacggtggcaccatatcgaacagaataaagttcaagttg
atagacgtgaaggaattgagggaaattaagcattggaacagcgctaagaaagacgccgga
ccaaagacaattcaacaaatccaccaagaagaagaacaattacgtcagaaaaagaacagt
cagagatcaaattctagattcaacaatcacaaccaatcgaacagcaacagatattcttct
aacagaaggaacatgcaaaacacccaaagagatagttttgcttccacgaaaacaggttct
ttcagaaataaccaaagaaatgctcgtaaagtcgaagaagtttctcaagctccaagagct
aatatgttcgacgcattaatgaataacgatggggacagtgattaa

KEGG   Saccharomyces cerevisiae (budding yeast): YGR162W
Entry
YGR162W           CDS       T00005                                 

Gene name
TIF4631
Definition
(RefSeq) translation initiation factor eIF4G
  KO
K03260  translation initiation factor 4G
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YGR162W (TIF4631)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YGR162W (TIF4631)
   03012 Translation factors [BR:sce03012]
    YGR162W (TIF4631)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     YGR162W (TIF4631)
   mRNA cycle factors
    Stress granule specific factors
     YGR162W (TIF4631)
Translation factors [BR:sce03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    YGR162W (TIF4631)
SSDB
Motif
Pfam: MIF4G eIF_4G1
Other DBs
NCBI-GeneID: 853071
NCBI-ProteinID: NP_011678
SGD: S000003394
UniProt: P39935
Structure
PDB: 
2VSX 2VSO 1RF8

Position
VII:824059..826917
AA seq 952 aa
MTDETAHPTQSASKQESAALKQTGDDQQESQQQRGYTNYNNGSNYTQKKPYNSNRPHQQR
GGKFGPNRYNNRGNYNGGGSFRGGHMGANSSNVPWTGYYNNYPVYYQPQQMAAAGSAPAN
PIPVEEKSPVPTKIEITTKSGEHLDLKEQHKAKLQSQERSTVSPQPESKLKETSDSTSTS
TPTPTPSTNDSKASSEENISEAEKTRRNFIEQVKLRKAALEKKRKEQLEGSSGNNNIPMK
TTPENVEEKGSDKPEVTEKTKPAEEKSAEPEVKQETPAEEGEQGEKGQIKEESTPKVLTF
AERLKLKKQQKEREEKTEGKENKEVPVQEETKSAIESAPVPPSEQVKEETEVAETEQSNI
DESATTPAIPTKSDEAEAEVEAEAGDAGTKIGLEAEIETTTDETDDGTNTVSHILNVLKD
ATPIEDVFSFNYPEGIEGPDIKYKKEHVKYTYGPTFLLQFKDKLNVKADAEWVQSTASKI
VIPPGMGRGNRSRDSGRFGNNSSRGHDFRNTSVRNMDDRANSRTSSKRRSKRMNDDRRSN
RSYTSRRDRERGSYRNEEKREDDKPKEEVAPLVPSANRWVPKFKSKKTEKKLAPDGKTEL
LDKDEVERKMKSLLNKLTLEMFDAISSEILAIANISVWETNGETLKAVIEQIFLKACDEP
HWSSMYAQLCGKVVKELNPDITDETNEGKTGPKLVLHYLVARCHAEFDKGWTDKLPTNED
GTPLEPEMMSEEYYAAASAKRRGLGLVRFIGFLYRLNLLTGKMMFECFRRLMKDLTDSPS
EETLESVVELLNTVGEQFETDSFRTGQATLEGSQLLDSLFGILDNIIQTAKISSRIKFKL
IDIKELRHDKNWNSDKKDNGPKTIQQIHEEEERQRQLKNNSRSNSRRTNNSSNRHSFRRD
APPASKDSFITTRTYSQRNSQRAPPPKEEPAAPTSTATNMFSALMGESDDEE
NT seq 2859 nt   +upstreamnt  +downstreamnt
atgacagacgaaactgctcacccgacacaatctgcttcaaagcaggaatctgctgctctg
aaacagacaggcgatgaccagcaggaatctcagcaacaacgtggctacaccaactacaac
aatggtagcaactatacccaaaagaagccttacaacagcaacagacctcatcagcaaaga
ggtggtaaatttggaccaaacagatataacaaccgtggcaactataatggtggcggtagt
ttcagaggtggacacatgggagccaacagctcaaacgtgccatggactggttactataat
aactaccccgtttactaccagccccagcaaatggcggccgctggtagtgcccctgctaat
ccaattcctgtcgaagagaagtcacctgttccaactaagatagaaatcactaccaagtct
ggtgaacacttagatttgaaagaacagcataaagccaagctacagtctcaggaaagatct
actgtgtctccgcaaccagagtcaaagttaaaagaaacttctgattctacttctacttct
actccaactcctaccccttccactaatgactctaaggccagttctgaagaaaatatatct
gaagctgaaaagacaagaagaaatttcatcgagcaagttaaacttcgtaaagctgcttta
gaaaagaagagaaaggagcaacttgaaggttctagtggcaacaataatattccaatgaag
actaccccagaaaatgtggaagagaagggatcggacaaacctgaggtaaccgaaaaaacc
aagcctgctgaagaaaaatctgctgagccagaagttaagcaagaaactccagctgaagaa
ggtgaacaaggagaaaagggccaaataaaggaagaatccactccaaaggtgttaaccttt
gctgaacgtttgaagttgaagaaacaacaaaaagaacgagaagaaaaaacggaggggaag
gaaaacaaggaagtgccagtacaggaagagactaagagcgccatcgagtctgctcctgtg
cctcccagtgaacaggttaaagaagaaactgaggtcgccgaaaccgaacagtcaaacatt
gatgaatctgcaacaactccggctatccctactaaatctgatgaagctgaagctgaagtt
gaggctgaagcaggtgatgctggaacaaagattggacttgaagctgaaatcgaaactaca
actgatgaaactgatgatggtacaaacaccgtttctcacatattgaatgtattgaaagat
gctacaccaattgaagatgtcttttcttttaactatccagaaggtattgaaggtcctgat
atcaaatacaagaaagaacacgtcaaatatacatatggcccaactttcttgcttcaattt
aaggacaaactaaacgtcaaagcggacgccgaatgggtccaaagcactgcttctaaaatt
gtcattccaccaggaatgggcagaggaaatagatctagagattctggcagattcggcaat
aattctagtcgtggccatgactttagaaatacctcagtgagaaatatggatgacagagct
aattcaagaacttcatcaaagagaagatcaaagagaatgaatgacgacaggagatctaat
agatcttatacatcaagaagagaccgcgagagaggctcctacagaaatgaagagaaaaga
gaggacgataaaccaaaggaagaagttgctccacttgttccaagtgctaataggtgggtg
ccaaaattcaagtctaaaaagactgaaaagaagctagcccctgacggaaagaccgaacta
ttggacaaggatgaagttgaaagaaagatgaagtcactactgaataaacttactttggaa
atgttcgatgctatttcatctgaaattttggctattgcaaacatatcagtatgggaaaca
aatggtgaaacgttaaaggctgtgatagaacagattttcttaaaggcctgtgacgaaccc
cattggtcttctatgtacgcgcaattatgtggtaaagtagttaaagaattaaacccagat
ataacagatgaaactaatgaaggtaagacaggtccaaaattggttttgcattacttggtt
gctagatgtcatgccgaatttgacaagggttggaccgataaattacccacaaacgaagat
ggtactccattagaacctgagatgatgtcagaagagtactatgcagctgcttctgctaag
agaagaggtttaggtttggttcgtttcatcggtttcctataccgtctgaatctgttgact
ggaaagatgatgttcgaatgtttccgtagactaatgaaggatttgacggattctccatct
gaagaaactctagagtccgttgttgaattgttaaatactgttggtgaacaatttgagacc
gatagtttcagaacgggtcaagcaacattggagggttcgcaattgctcgatagtttgttc
ggtattttagacaatattattcaaactgctaagatttctagtagaatcaagttcaagttg
atcgacattaaagaattaaggcacgacaagaactggaacagtgataagaaggacaacggt
cctaagaccattcaacagattcatgaggaagaggagagacaacgtcaattgaagaataat
tcaagatctaattcaagacgtacgaacaactccagtaatagacactctttcagaagggac
gctcctcctgcatcaaaagatagctttatcacaaccagaacatattctcaaagaaatagc
caaagggctcctcctccaaaggaagaaccagctgcaccaacttctaccgcaacaaatatg
ttcagtgcattaatgggagaaagtgatgacgaagagtaa

DBGET integrated database retrieval system