KEGG   Saccharomyces cerevisiae (budding yeast): YGL100W
Entry
YGL100W           CDS       T00005                                 

Gene name
SEH1
Definition
(RefSeq) Seh1p
  KO
K14299  nucleoporin SEH1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YGL100W (SEH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YGL100W (SEH1)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     YGL100W (SEH1)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40
Other DBs
NCBI-GeneID: 852778
NCBI-ProteinID: NP_011415
SGD: S000003068
UniProt: P53011
Structure
PDB: 
3F3F 3F3P 3EWE 3F3G 4XMM

Position
VII:313234..314283
AA seq 349 aa
MQPFDSGHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDKDTSNWELSDSWRAHDSSIVA
IDWASPEYGRIIASASYDKTVKLWEEDPDQEECSGRRWNKLCTLNDSKGSLYSVKFAPAH
LGLKLACLGNDGILRLYDALEPSDLRSWTLTSEMKVLSIPPANHLQSDFCLSWCPSRFSP
EKLAVSALEQAIIYQRGKDGKLHVAAKLPGHKSLIRSISWAPSIGRWYQLIATGCKDGRI
RIFKITEKLSPLASEESLTNSNMFDNSADVDMDAQGRSDSNTEEKAELQSNLQVELLSEH
DDHNGEVWSVSWNLTGTILSSAGDDGKVRLWKATYSNEFKCMSVITAQQ
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgcaaccatttgatagtgggcatgatgatttagttcatgatgtcgtttatgacttttac
ggaagacatgtggcaacatgctcttctgatcaacatattaaagtttttaaattagacaag
gacacgagtaattgggaactcagtgactcatggagagctcacgacagtagtatcgtggcc
attgattgggccagtccagaatatgggcgcatcattgcttcagcctcttacgataagacg
gtaaaattatgggaagaagatcccgaccaagaagaatgctctggccgtcgttggaacaag
ctgtgtaccctgaatgattccaaaggatcactttatagtgtaaaatttgcgccagcgcat
ttgggcttaaaattagcttgtttgggtaacgatggaatcctcagactttatgatgcctta
gaaccttctgacctaaggtcatggacactgacttctgagatgaaagtgctatctatacca
ccagcaaatcatttacagtctgatttttgtctctcttggtgtccttcgagattttctcct
gaaaagctcgcagtctctgcattggaacaagcgattatataccaaaggggtaaagacggt
aaacttcacgttgcagcaaaacttcccggtcataaaagtttaataagaagtatcagctgg
gctccttccattggtagatggtatcaactcattgcaacaggttgcaaagatggtagaatt
agaattttcaaaatcacagaaaaactaagtcccctggcctcagaggagtctttaactaac
tcaaatatgtttgataatagtgctgatgttgacatggatgcacagggcagatcagactca
aataccgaagagaaagctgagctacaatcaaacttgcaagttgaacttctaagcgagcat
gatgaccataatggcgaagtttggtccgtgtcttggaatttaacgggtacaatcttaagc
agtgctggggatgatgggaaggtacgtttatggaaagccacttattcaaatgaatttaag
tgtatgtcagtaattactgcccaacaataa

DBGET integrated database retrieval system