KEGG   Saccharomyces cerevisiae (budding yeast): YGL172W
Entry
YGL172W           CDS       T00005                                 

Gene name
NUP49, NSP49
Definition
(RefSeq) FG-nucleoporin NUP49
  KO
K14307  nucleoporin p58/p45
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YGL172W (NUP49)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YGL172W (NUP49)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     YGL172W (NUP49)
SSDB
Motif
Pfam: Nucleoporin_FG Fibin Lzipper-MIP1
Other DBs
NCBI-GeneID: 852703
NCBI-ProteinID: NP_011343
SGD: S000003140
UniProt: Q02199
Position
VII:180700..182118
AA seq 472 aa
MFGLNKASSTPAGGLFGQASGASTGNANTGFSFGGTQTGQNTGPSTGGLFGAKPAGSTGG
LGASFGQQQQQSQTNAFGGSATTGGGLFGNKPNNTANTGGGLFGANSNSNSGSLFGSNNA
QTSRGLFGNNNTNNINNSSSGMNNASAGLFGSKPAGGTSLFGNTSTSSAPAQNQGMFGAK
PAGTSLFGNNAGNTTTGGGLFGSKPTGATSLFGSSNNNNNNNNSNNIMSASGGLFGNQQQ
QLQQQPQMQCALQNLSQLPITPMTRISELPPQIRQEIEQLDQYIQKQVQISHHLKADTID
HDELIDSIPRDVAYLLKSESATSQYLKQDLKKISSFKSLIDEDLLDTQTFSVLLQQLLTP
GSKISSNDLDKFFQKKIHLYEKKLEDYCRILSDIETAVNGIDTDLFGAPNNPNSTAITAD
LGSSEAENLLQLKTGLAAIVSTVIEEFTLFMDIAERIAVLHQKTKTLASLSI
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgtttggattaaataaagcatcttcgacacctgcaggtgggctctttggtcaggccagc
ggagctagcactggaaacgcgaatactgggttttcgtttggtgggactcaaactggacaa
aacaccggcccaagtacaggtggactatttggcgctaaaccagccggatctacaggagga
ttaggtgcatcatttggtcagcagcaacaacaatctcagacaaatgcatttggaggaagc
gccaccaccggagggggccttttcggtaacaaacctaacaatacggcgaacactgggggc
gggttatttggcgctaattcgaacagtaattctggcagtttgtttggttccaacaatgca
cagacgagtcgtggtttgtttggtaataataacactaataatatcaataatagtagtagt
ggcatgaataatgcaagcgctggactatttggctctaaacctgcaggaggcacttctttg
ttcggtaatacaagcacctcttcggcccctgcgcagaaccagggcatgtttggtgcaaaa
ccagctggtacatctctattcggcaataatgcaggtaatacgaccactggtggagggtta
tttggctccaaaccgacaggagcaacgtctttgtttggttcatcaaataacaacaacaat
aacaataatagtaacaacatcatgagtgcgtcaggcgggctatttggtaatcagcagcag
caactgcagcaacaaccacaaatgcagtgcgcattgcaaaatctatctcagctccctatt
accccaatgacacggatttccgaattaccacctcaaatacgtcaagaaattgaacaacta
gatcaatatattcaaaaacaagtgcagatctcgcaccatttgaaggccgatacaatcgat
catgatgaattgatagattccattcctcgtgatgttgcatacctactgaagtcagaatct
gcaacaagtcaatatttaaagcaagatttgaagaaaatatcctcatttaaatcgctaatc
gatgaggaccttctagacacgcaaactttttcggtgctcttacagcaactattaactccg
ggaagcaaaatttcttctaatgacttagacaaattctttcaaaagaaaattcatctctac
gagaagaagttagaggattactgccgtattctctctgatatagaaactgcggtaaatggc
attgatacagatttatttggcgccccaaataaccctaattctacagctatcacagcagat
ctaggttcatccgaagcagagaacctactgcagttgaagacaggcttagctgccatagtc
tctactgtcattgaggaattcacactgtttatggatatcgctgagagaatcgccgtgtta
catcaaaaaacgaaaacactggcatcattgagcatatga

DBGET integrated database retrieval system