KEGG   Saccharomyces cerevisiae (budding yeast): YGR072W
Entry
YGR072W           CDS       T00005                                 

Gene name
UPF3, SUA6, SUP112
Definition
(RefSeq) Upf3p
  KO
K14328  regulator of nonsense transcripts 3
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
sce03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YGR072W (UPF3)
   03015 mRNA surveillance pathway
    YGR072W (UPF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YGR072W (UPF3)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Surveillance complex
     YGR072W (UPF3)
   mRNA cycle factors
    P-body specific factors
     YGR072W (UPF3)
SSDB
Motif
Pfam: Smg4_UPF3
Other DBs
NCBI-GeneID: 852963
NCBI-ProteinID: NP_011586
SGD: S000003304
UniProt: P48412
Position
VII:634304..635467
AA seq 387 aa
MSNVAGELKNSEGKKKGRGNRYHNKNRGKSKNETVDPKKNENKVNNATNATHNNSKGRRN
NKKRNREYYNYKRKARLGKSTENEGFKLVIRLLPPNLTADEFFAILRDNNNDDGDKQDIQ
GKLKYSDWCFFEGHYSSKVFKNSTYSRCNFLFDNLSDLEKCANFIKTCKFIDNKDNITIP
DMKLSPYVKKFTQTSKKDAALVGTIEEDEIFKTFMNSMKQLNENDEYSFQDFSVLKSLEK
EFSKSIELENKIAERTERVLTELVGTGDKVKNKNKKKKNKNAKKKFKEEEASAKIPKKKR
NRGKKKRENREKSTISKTKNSNVVIIEEAGKEVLKQRKKKMLLQEKLKISNSSQPQSSSA
QTQPSFQPKENLFVPRVKILHRDDTKK
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgagcaatgtggctggggaattgaagaatagtgaggggaaaaagaaaggcaggggaaat
aggtatcataacaagaacagaggaaaaagtaagaatgagacggtagatcctaaaaagaat
gagaataaggttaataatgctactaatgctacccacaacaatagcaaaggcagaaggaat
aacaagaaaaggaacagagagtattataactataaaagaaaggctagattgggtaaatca
accgagaatgaaggatttaagcttgttattagattgctacctccaaatttgactgcagat
gaattttttgccatcttacgagataataataacgatgatggtgataagcaagatatccag
ggtaaactcaagtacagtgactggtgtttttttgaaggtcattattctagtaaagtattc
aaaaactcgacatattctcggtgcaatttcttgttcgacaacttatcagacttggaaaaa
tgcgcaaatttcattaaaacttgtaaattcattgataataaggataatattacaattcca
gatatgaaactgtcgccctacgtaaagaaattcactcaaacatcaaaaaaggatgccgcg
ctagtaggaacaattgaagaagacgaaatttttaaaacatttatgaattcaatgaaacag
ctgaatgaaaatgacgagtactcattccaagattttagcgtattgaaatctttagaaaaa
gaattctcaaaaagcatagagttagaaaataaaatagcagaaagaacagaaagggtgtta
acagagctggttggaactggtgataaggtcaagaataagaacaaaaagaagaaaaataaa
aacgccaaaaagaaattcaaagaagaggaagcatccgctaagataccaaagaaaaaacgg
aacagaggcaagaagaagcgtgaaaatcgtgaaaaaagcaccatttctaagaccaagaac
agtaatgtggttattattgaggaagcgggtaaagaggttttgaaacaaaggaagaagaaa
atgcttttgcaagagaagttaaaaatatcaaactcctctcagcctcagtcatcatccgct
caaacccagccgtcgttccaacctaaagaaaaccttttcgtaccacgggtaaaaattttg
catcgtgatgataccaagaagtag

DBGET integrated database retrieval system