KEGG   Saccharomyces cerevisiae (budding yeast): YGR119C
Entry
YGR119C           CDS       T00005                                 

Gene name
NUP57
Definition
(RefSeq) FG-nucleoporin NUP57
  KO
K14308  nuclear pore complex protein Nup54
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YGR119C (NUP57)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YGR119C (NUP57)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     YGR119C (NUP57)
SSDB
Motif
Pfam: Nup54 Nucleoporin_FG
Other DBs
NCBI-GeneID: 853016
NCBI-ProteinID: NP_011634
SGD: S000003351
UniProt: P48837
Position
VII:complement(728046..729671)
AA seq 541 aa
MFGFSGSNNGFGNKPAGSTGFSFGQNNNNTNTQPSASGFGFGGSQPNSGTATTGGFGANQ
ATNTFGSNQQSSTGGGLFGNKPALGSLGSSSTTASGTTATGTGLFGQQTAQPQQSTIGGG
LFGNKPTTTTGGLFGNSAQNNSTTSGGLFGNKVGSTGSLMGGNSTQNTSNMNAGGLFGAK
PQNTTATTGGLFGSKPQGSTTNGGLFGSGTQNNNTLGGGGLFGQSQQPQTNTAPGLGNTV
STQPSFAWSKPSTGSNLQQQQQQQIQVPLQQTQAIAQQQQLSNYPQQIQEQVLKCKESWD
PNTTKTKLRAFVYNKVNETEAILYTKPGHVLQEEWDQAMEKKPSPQTIPIQIYGFEGLNQ
RNQVQTENVAQARIILNHILEKSTQLQQKHELDTASRILKAQSRNVEIEKRILKLGTQLA
TLKNRGLPLGIAEEKMWSQFQTLLQRSEDPAGLGKTNELWARLAILKERAKNISSQLDSK
LMVFNDDTKNQDSMSKGTGEESNDRINKIVEILTNQQRGITYLNEVLEKDAAIVKKYKNK
T
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgtttggtttcagcggtagtaataacgggttcggaaataaaccagctggttcgaccggt
ttttcatttggacaaaacaataacaatacaaatactcaaccttcggcttcaggatttggt
tttgggggcagccagccaaattctgggacggctactaccggagggtttggtgcaaatcag
gccacaaatacttttggaagtaaccaacaaagtagtacaggtggaggccttttcggtaat
aagcctgctcttggcagcctaggaagttcaagcactaccgcttcaggaactacagctact
ggaacaggtttatttgggcaacaaacagcacaacctcaacaatccaccattggaggtggg
ttatttggaaacaagccaactaccacaacgggaggtcttttcggcaacagtgcacaaaac
aatagtaccacaagtgggggtttatttggtaataaagtaggatccactggctcactgatg
ggcggcaatagcactcaaaacacatctaacatgaatgcaggcggactttttggtgcaaag
cctcagaatactacagcgactacgggaggcctatttggcagtaagccacaaggatcaaca
actaatggtggcctgtttggaagcggcacccagaataacaatacccttgggggaggtggc
ctttttggccaatcccagcagcctcaaacaaacactgcgcccggacttggaaacacggta
tccacacaaccatcatttgcttggtctaagccttcaactggatctaatttacagcagcag
cagcagcagcaaattcaagtaccgttgcaacaaacgcaagcaattgctcaacaacagcag
ctgtctaattatccgcagcaaattcaagaacaggtgttgaaatgtaaagaatcgtgggat
ccaaacacaacgaaaacaaaactcagggctttcgtgtacaataaagtgaacgaaacggaa
gccattttatatacaaaaccaggacatgtacttcaagaagagtgggatcaggcaatggaa
aagaaaccttcccctcagacaattcccattcaaatatatggatttgagggtttgaatcaa
cgtaatcaagtacagactgaaaatgtagcccaagctagaataattttgaaccatatttta
gagaaatccacacaattgcaacaaaagcatgaattggacactgcgtccagaattttgaag
gcacaatcaaggaatgttgaaattgaaaaaagaatcttaaaattgggcacacaattggca
accctgaaaaatagaggactgccattgggtattgcagaagagaaaatgtggtcgcaattc
caaactttactacagcggagcgaagatcctgcaggtttaggtaagactaacgaactttgg
gcacgtttggctatcttaaaagaacgtgctaaaaacatttctagtcaattagatagtaaa
ttaatggttttcaacgacgatacaaaaaaccaagacagcatgtccaaaggcaccggtgaa
gaatctaatgatcgtattaataagatagtggaaattctgacgaatcaacaacgcggtata
acatatttaaatgaggttttagagaaagatgctgcaattgtaaaaaaatataaaaataaa
acgtaa

DBGET integrated database retrieval system