KEGG   Saccharomyces cerevisiae (budding yeast): YGR218W
Entry
YGR218W           CDS       T00005                                 

Gene name
CRM1, KAP124, XPO1
Definition
(RefSeq) exportin CRM1
  KO
K14290  exportin-1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03008  Ribosome biogenesis in eukaryotes
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YGR218W (CRM1)
   03008 Ribosome biogenesis in eukaryotes
    YGR218W (CRM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YGR218W (CRM1)
   03009 Ribosome biogenesis [BR:sce03009]
    YGR218W (CRM1)
   03016 Transfer RNA biogenesis [BR:sce03016]
    YGR218W (CRM1)
   03036 Chromosome and associated proteins [BR:sce03036]
    YGR218W (CRM1)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     YGR218W (CRM1)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic type
  Pre-40S particles
   Export and cytoplasmic maturation factors
    YGR218W (CRM1)
  Pre-60S particles
    YGR218W (CRM1)
Transfer RNA biogenesis [BR:sce03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    YGR218W (CRM1)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     YGR218W (CRM1)
SSDB
Motif
Pfam: CRM1_C Xpo1 CRM1_repeat_2 CRM1_repeat_3 CRM1_repeat IBN_N CUE
Other DBs
NCBI-GeneID: 853133
NCBI-ProteinID: NP_011734
SGD: S000003450
UniProt: P30822
Structure
PDB: 

Position
VII:932541..935795
AA seq 1084 aa
MEGILDFSNDLDIALLDQVVSTFYQGSGVQQKQAQEILTKFQDNPDAWQKADQILQFSTN
PQSKFIALSILDKLITRKWKLLPNDHRIGIRNFVVGMIISMCQDDEVFKTQKNLINKSDL
TLVQILKQEWPQNWPEFIPELIGSSSSSVNVCENNMIVLKLLSEEVFDFSAEQMTQAKAL
HLKNSMSKEFEQIFKLCFQVLEQGSSSSLIVATLESLLRYLHWIPYRYIYETNILELLST
KFMTSPDTRAITLKCLTEVSNLKIPQDNDLIKRQTVLFFQNTLQQIATSVMPVTADLKAT
YANANGNDQSFLQDLAMFLTTYLARNRALLESDESLRELLLNAHQYLIQLSKIEERELFK
TTLDYWHNLVADLFYEVQRLPATEMSPLIQLSVGSQAISTGSGALNPEYMKRFPLKKHIY
EEICSQLRLVIIENMVRPEEVLVVENDEGEIVREFVKESDTIQLYKSEREVLVYLTHLNV
IDTEEIMISKLARQIDGSEWSWHNINTLSWAIGSISGTMSEDTEKRFVVTVIKDLLDLTV
KKRGKDNKAVVASDIMYVVGQYPRFLKAHWNFLRTVILKLFEFMHETHEGVQDMACDTFI
KIVQKCKYHFVIQQPRESEPFIQTIIRDIQKTTADLQPQQVHTFYKACGIIISEERSVAE
RNRLLSDLMQLPNMAWDTIVEQSTANPTLLLDSETVKIIANIIKTNVAVCTSMGADFYPQ
LGHIYYNMLQLYRAVSSMISAQVAAEGLIATKTPKVRGLRTIKKEILKLVETYISKARNL
DDVVKVLVEPLLNAVLEDYMNNVPDARDAEVLNCMTTVVEKVGHMIPQGVILILQSVFEC
TLDMINKDFTEYPEHRVEFYKLLKVINEKSFAAFLELPPAAFKLFVDAICWAFKHNNRDV
EVNGLQIALDLVKNIERMGNVPFANEFHKNYFFIFVSETFFVLTDSDHKSGFSKQALLLM
KLISLVYDNKISVPLYQEAEVPQGTSNQVYLSQYLANMLSNAFPHLTSEQIASFLSALTK
QYKDLVVFKGTLRDFLVQIKEVGGDPTDYLFAEDKENALMEQNRLEREKAAKIGGLLKPS
ELDD
NT seq 3255 nt   +upstreamnt  +downstreamnt
atggaaggaattttggatttttctaacgacttagatatcgctctattagatcaggtggta
tctacattctatcaaggttcaggtgttcagcaaaagcaagcccaagagattttgactaaa
tttcaagataatccagacgcttggcaaaaagctgaccaaattcttcaattctcaactaac
cctcaatcaaaatttattgccctttccatccttgataaattaattactagaaaatggaaa
ttgttgccgaatgatcatagaattggaattaggaacttcgttgttggtatgattatctcc
atgtgccaagacgatgaagtatttaaaacacaaaagaacctgatcaataagtcggacttg
actttggtccaaattttaaagcaggaatggcctcagaattggcctgaatttatcccagaa
ctaatcggcagttcaagttcctctgttaatgtttgtgaaaataacatgatcgttttgaaa
ctgctatccgaagaagtcttcgatttctctgcggaacaaatgacacaagctaaagcttta
catttgaaaaattccatgtcaaaagaatttgaacagatttttaaattatgttttcaagtt
ttggaacaaggttcttcaagctctctaatagtggcaaccttagaatctttactgagatat
ttacattggattccttatcgttatatttatgaaaccaatattttggaattattaagcacc
aaattcatgacatcgcctgatacaagagccatcacattgaaatgtttgactgaggtttca
aatctaaaaattccacaagataatgatttgataaaaagacaaactgtactttttttccaa
aatactctacaacaaattgccacaagtgtgatgcccgtgactgccgatctgaaagccact
tatgcaaatgctaacggtaatgatcaatctttcttacaagatttagcaatgtttctaact
acatatctcgctcgtaatagggcccttctagagagtgatgaatcgttaagagagttgttg
ttgaatgcgcaccaatacttaattcaattatccaaaatcgaagaaagagaactatttaag
acgacattggattactggcataatttagtagcagatttgttttatgaggttcagcgtttg
cctgctaccgaaatgagcccattgatacagttatcagtcggttcacaagctatctcaact
ggatctggcgccctaaatccggaatatatgaaaagatttccattaaaaaaacatatttac
gaagaaatttgttcacagttgagattggtcattattgaaaatatggttagaccagaagaa
gtccttgtggttgaaaatgatgaaggagaaattgttagagagttcgttaaagaatcagac
actatccaattatacaaatcagaaagagaggttcttgtatatttgacccatttgaatgtt
atcgatacagaagaaatcatgatcagtaaattggcaaggcaaatcgatggttccgaatgg
tcatggcataatatcaacactttatcttgggctattggttccatatctggtacaatgagc
gaagatactgaaaaaaggtttgtagttactgttattaaagatttactagatttaacggtc
aagaaaaggggtaaagataataaagctgttgttgcatcggatattatgtacgtcgtgggc
caatatcctagatttttgaaggctcactggaattttctaagaacagttattttgaaactt
tttgaatttatgcatgaaactcatgagggtgttcaggatatggcatgtgacacattcatt
aagattgttcaaaaatgtaaatatcattttgttattcaacaaccccgtgagtctgagcct
ttcatccaaacaataattagggatattcaaaagacaactgctgacctacagccgcaacag
gtccatacattttacaaggcttgtggtattattatttctgaagaaagaagcgtagcggag
agaaatagattattaagtgatttgatgcaactgccaaatatggcttgggacactatagtg
gaacaatccactgctaacccaacattgttgttagattctgaaactgtcaaaattattgcg
aatattataaaaaccaatgtagctgtctgcacctcaatgggagcagatttctatccacag
ttgggtcacatctattacaatatgcttcagctatacagagctgtttcttcgatgatttct
gctcaagttgccgcagaaggtctaattgctacgaagacaccaaaggttcgtggtttgaga
accatcaaaaaagagattctgaagcttgttgagacctatatatccaaggcgagaaatttg
gatgatgtcgttaaagtgttagttgagccattattgaacgctgtacttgaagactatatg
aacaacgttcctgatgcaagggacgccgaagtgctaaattgtatgacaacagtagtagaa
aaggttggtcatatgatcccacaaggtgttattttaattttacagagtgtatttgaatgc
actttggacatgattaacaaagacttcacagaatatccagagcatcgtgtagaattttac
aagttattgaaggtcatcaatgagaaatcatttgctgcatttttggaactacctccggct
gcctttaaattgtttgttgacgctatttgttgggcgttcaaacataacaatagagatgtc
gaagttaatggtctacagattgcattagacctagtgaaaaacattgaaagaatgggaaat
gtcccatttgcaaatgagttccacaagaattattttttcatttttgtcagtgaaacgttt
tttgttttaaccgattccgaccacaaatccggtttttctaagcaagctttgttactaatg
aagttgatttctttggtttatgataacaagatttcggtaccattatatcaagaagctgag
gtaccacaaggaacttcaaatcaagtctacttaagccaatatttggctaatatgttaagt
aatgcattcccccatttaacatccgaacaaatcgcaagttttctctctgcattaactaaa
caatacaaagacttagtggtcttcaaaggcactttgagggactttttggtgcaaatcaaa
gaagtcggaggtgatccaacagattatttgtttgctgaagataaagagaatgcattaatg
gaacagaatagactagagagggaaaaagctgccaagattggtgggttattaaaaccttcc
gaacttgatgattag

DBGET integrated database retrieval system