KEGG   Saccharomyces cerevisiae (budding yeast): YHR077C
Entry
YHR077C           CDS       T00005                                 

Gene name
NMD2, IFS1, SUA1, SUP111, UPF2
Definition
(RefSeq) Nmd2p
  KO
K14327  regulator of nonsense transcripts 2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
sce03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YHR077C (NMD2)
   03015 mRNA surveillance pathway
    YHR077C (NMD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YHR077C (NMD2)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Surveillance complex
     YHR077C (NMD2)
   mRNA cycle factors
    P-body specific factors
     YHR077C (NMD2)
SSDB
Motif
Pfam: MIF4G Upf2 Nop14
Other DBs
NCBI-GeneID: 856476
NCBI-ProteinID: NP_011944
SGD: S000001119
UniProt: P38798
Structure
PDB: 
4LUN

Position
VIII:complement(join(252374..255637,255751..255756))
AA seq 1089 aa
MDDGRKKELHDLNTRAWNGEEVFPLKSKKLDSSIKRNTGFIKKLKKGFVKGSESSLLKDL
SEASLEKYLSEIIVTVTECLLNVLNKNDDVIAAVEIISGLHQRFNGRFTSPLLGAFLQAF
ENPSVDIESERDELQRITRVKGNLRVFTELYLVGVFRTLDDIESKDAIPNFLQKKTGRKD
PLLFSILREILNYKFKLGFTTTIATAFIKKFAPLFRDDDNSWDDLIYDSKLKGALQSLFK
NFIDATFARATELHKKVNKLQREHQKCQIRTGKLRDEYVEEYDKLLPIFIRFKTSAITLG
EFFKLEIPELEGASNDDLKETASPMITNQILPPNQRLWENEDTRKFYEILPDISKTVEES
QSSKTEKDSNVNSKNINLFFTDLEMADCKDIIDDLSNRYWSSYLDNKATRNRILKFFMET
QDWSKLPVYSRFIATNSKYMPEIVSEFINYLDNGFRSQLHSNKINVKNIIFFSEMIKFQL
IPSFMIFHKIRTLIMYMQVPNNVEILTVLLEHSGKFLLNKPEYKELMEKMVQLIKDKKND
RQLNMNMKSALENIITLLYPPSVKSLNVTVKTITPEQQFYRILIRSELSSLDFKHIVKLV
RKAHWDDVAIQKVLFSLFSKPHKISYQNIPLLTKVLGGLYSYRRDFVIRCIDQVLENIER
GLEINDYGQNMHRISNVRYLTEIFNFEMIKSDVLLDTIYHIIRFGHINNQPNPFYLNYSD
PPDNYFRIQLVTTILLNINRTPAAFTKKCKLLLRFFEYYTFIKEQPLPKETEFRVSSTFK
KYENIFGNTKFERSENLVESASRLESLLKSLNAIKSKDDRVKGSSASIHNGKESAVPIES
ITEDDEDEDDENDDGVDLLGEDEDAEISTPNTESAPGKHQAKQDESEDEDDEDDDEDDDD
DDDDDDDDGEEGDEDDDEDDDDEDDDDEEEEDSDSDLEYGGDLDADRDIEMKRMYEEYER
KLKDEEERKAEEELERQFQKMMQESIDARKSEKVVASKIPVISKPVSVQKPLLLKKSEEP
SSSKETYEELSKPKKIAFTFLTKSGKKTQSRILQLPTDVKFVSDVLEEEEKLKTERNKIK
KIVLKRSFD
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggacgatggacggaaaaaagaattgcatgatttgaacacccgagcttggaatggcgaa
gaagtctttcccctgaaaagtaaaaaactggattccagtataaagagaaacactggcttt
ataaaaaaactaaagaagggttttgtgaaaggttcagaatcttcattattgaaagattta
agtgaggcgtccttggaaaagtacctatcagagataatagtgacggtaacagaatgtctg
ctaaatgttttgaataaaaatgatgacgtaattgccgctgttgagatcataagtggactt
catcaaaggttcaatggccgatttactagtccgcttttaggagcttttttacaagctttt
gagaacccctctgttgacattgaatccgaaagagatgagcttcaaaggataaccagagtt
aaaggtaatcttcgggtatttaccgagctttatttagttggagtttttagaacattggat
gatattgagtcgaaagatgctattccaaacttcctacagaagaaaactgggcgaaaggat
ccgttgttattcagtattctcagagagattcttaattataagttcaaattgggctttact
accactattgcgaccgcatttattaagaaatttgcacctttgtttcgcgacgatgataat
tcttgggatgatttaatatatgactcgaagttaaaaggtgcgttacagtctctgtttaag
aattttatagacgccacttttgcgagggccacagaactgcataagaaggtcaataaactg
caaagagaacatcagaaatgccaaataagaacgggaaaattgagagatgagtacgtagag
gagtacgacaagttacttccaatattcattaggttcaagacatctgcaattactttggga
gaattttttaagttagaaattccggagcttgaaggtgcctctaatgatgatctgaaagaa
acagcttctccaatgatcacgaatcagatattgccacccaaccaacgattatgggaaaat
gaagatacaaggaaattttatgaaatcttaccagatatctcaaaaacagtagaagaatca
caatcttctaaaacagaaaaagattcaaacgttaactcaaaaaatatcaatctattcttt
acggatttggaaatggcagattgtaaagatataatcgatgacctttcaaatagatattgg
tcatcatatttggacaacaaagccacaagaaatcgaatattgaaatttttcatggaaaca
caagattggagcaaactgccagtgtattccagatttattgcaacaaatagcaaatatatg
ccggaaattgtttctgagtttattaactacctagacaatggcttcaggagtcaattacat
tctaataagattaacgttaaaaacatcatcttcttcagtgaaatgattaaatttcaatta
ataccatcgtttatgatttttcataagattagaacattaatcatgtatatgcaagttcca
aataacgtagaaattttgacggttttgttggagcactcagggaaatttctgctaaataag
ccagaatataaggaattaatggaaaaaatggtccaactaatcaaggataaaaaaaatgat
aggcaattgaacatgaacatgaaaagcgccttagaaaacataattactttactttatccc
ccttctgtaaaatcattaaatgttacggtaaaaacaataacgcctgaacaacagttttat
cgcatattaattagaagtgaactaagtagcctagacttcaaacacattgtcaagttggtt
cggaaagctcactgggacgatgtagctattcagaaagtgctgttttctctgttttcaaaa
ccacataagattagctatcaaaatattcccttattaacaaaagttctaggcggtctatac
agttaccgccgcgatttcgtcatcagatgtatagaccaagtactggaaaacattgagcga
ggcttagaaattaacgattatggacaaaacatgcatagaatatcaaatgtcagatactta
actgaaatattcaactttgaaatgataaaatccgatgttttgttagatactatctaccac
attattcggtttggtcatatcaacaatcaacccaatccattttatttaaactactcagat
ccaccggataattatttcaggattcaactagtcactacaattctgttaaatatcaacagg
acccctgcagcttttactaagaaatgcaaacttttgctgaggtttttcgagtattatact
tttattaaagaacaacctttacccaaggaaacagaattcagagtttcaagcacatttaaa
aaatatgagaatattttcggaaacactaaatttgaaaggtcagaaaatttggtagaaagt
gcctcaaggttggaaagtttactgaaatcattaaacgcaataaaaagtaaagacgacaga
gtgaagggatcttctgcaagcattcacaacggtaaggagagtgctgttcctatcgagtca
atcaccgaagatgatgaggatgaagatgatgaaaacgacgatggtgtcgatttactagga
gaagatgaagacgcggagataagtacaccgaacacagagtcagcgccaggaaaacatcag
gcaaagcaagacgaaagtgaagatgaagacgatgaggacgatgacgaggatgatgacgat
gacgatgacgatgatgatgatgatggagaagaaggcgatgaggatgatgatgaagatgat
gatgatgaggatgatgatgatgaagaagaagaagacagcgactctgatttggagtatggt
ggtgatcttgacgcagacagagatattgaaatgaaacgaatgtatgaagagtacgagaga
aaactaaaggatgaggaagaaaggaaagcggaagaagaattggaaaggcaatttcagaaa
atgatgcaagaatccatagacgcaaggaaaagcgaaaaggttgttgccagtaaaattcca
gtaatttcgaagccagtcagcgttcaaaaacctttattattaaaaaagagtgaagaacct
tcttcaagcaaggagacctacgaagagttatccaagccaaagaagattgcatttacgttc
ttgactaaaagcggtaagaagacacaatcaagaattttacaattaccaacggatgtgaaa
tttgtctctgatgtccttgaagaagaagagaaactaaaaaccgagcgaaacaagattaaa
aagattgttttaaaacgttctttcgactga

DBGET integrated database retrieval system