KEGG   Saccharomyces cerevisiae (budding yeast): YJL095W
Entry
YJL095W           CDS       T00005                                 

Symbol
BCK1, LAS3, SAP3, SLK1, SSP31
Name
(RefSeq) mitogen-activated protein kinase kinase kinase BCK1
  KO
K11229  mitogen-activated protein kinase kinase kinase [EC:2.7.11.25]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04011  MAPK signaling pathway - yeast
sce04139  Mitophagy - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    YJL095W (BCK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04139 Mitophagy - yeast
    YJL095W (BCK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sce01001]
    YJL095W (BCK1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     YJL095W (BCK1)
Protein kinases [BR:sce01001]
 Serine/threonine kinases: STE group
  Other
   YJL095W (BCK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal ABC1 Mrr_N APH
Other DBs
NCBI-GeneID: 853350
NCBI-ProteinID: NP_012440
SGD: S000003631
UniProt: Q01389
Position
X:247255..251691
AA seq 1478 aa
MPFLRKIAGTAHTHSRSDSNSSVKFGHQPTSSVASTKSSSKSPRATSRKSIYDDIRSQFP
NLTPNSTSSQFYESTPVIEQSFNWTTDDHISAGTLENPTSFTNSSYKNDNGPSSLSDSRK
SSGGNSVNSLSFDKLILSWDPTDPDEWTMHRVTSWFKFHDFPESWILFFKKHQLFGHRFI
KLLAYDNFAVYEKYLPQTKTASYTRFQQLLKKTMTKNVTNSHIRQKSASKLKSSRSSSES
IKSKLKNSKSQEDISNSRSTSESALSPTKSGPSKTDEKNFLHSTSTHQKTKSASSLYRRS
FISLRGSSSSNASSAKSPSNIKLSIPARPHSIIESNSTLTKSASPPASPSYPSIFRRHHK
SSSSESSLLNSLFGSGIGEEAPTKPNPQGHSLSSENLAKGKSKHYETNVSSPLKQSSLPT
SDDKGNLWNKFKRKSQIGVPSPNTVAYVTSQETPSLKSNSSTATLTVQTADVNIPSPSSS
PPPIPKTANRSLEVISTEDTPKISSTTASFKETYPDCINPDKTVPVPVNNQKYSVKNFLL
DQKFYPLKKTGLNDSENKYILVTKDNVSFVPLNLKSVAKLSSFKESALTKLGINHKNVTF
HMTDFDCDIGAAIPDDTLEFLKKSLFLNTSGKIYIKDQMKLQQKPKPAPLTSENNVPLKS
VKSKSSMRSGTSSLIASTDDVSIVTSSSDITSFDEHASGSGRRYPQTPSYYYDRVSNTNP
TEELNYWNIKEVLSHEENAPKMVFKTSPKLELNLPDKGSKLNIPTPITENESKSSFQVLR
KDEGTEIDFNHRRESPYTKPELAPKREAPKPPANTSPQRTLSTSKQNKPIRLVRASTKIS
RSKRSKPLPPQLLSSPIEASSSSPDSLTSSYTPASTHVLIPQPYKGANDVMRRLKTDQDS
TSTSPSLKMKQKVNRSNSTVSTSNSIFYSPSPLLKRGNSKRVVSSTSAADIFEENDITFA
DAPPMFDSDDSDDDSSSSDDIIWSKKKTAPETNNENKKDEKSDNSSTHSDEIFYDSQTQD
KMERKMTFRPSPEVVYQNLEKFFPRANLDKPITEGIASPTSPKSLDSLLSPKNVASSRTE
PSTPSRPVPPDSSYEFIQDGLNGKNKPLNQAKTPKRTKTIRTIAHEASLARKNSVKLKRQ
NTKMWGTRMVEVTENHMVSINKAKNSKGEYKEFAWMKGEMIGKGSFGAVYLCLNVTTGEM
MAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLDHLNIVQYLGFENKNNIYSLFLEYV
AGGSVGSLIRMYGRFDEPLIKHLTTQVLKGLAYLHSKGILHRDMKADNLLLDQDGICKIS
DFGISRKSKDIYSNSDMTMRGTVFWMAPEMVDTKQGYSAKVDIWSLGCIVLEMFAGKRPW
SNLEVVAAMFKIGKSKSAPPIPEDTLPLISQIGRNFLDACFEINPEKRPTANELLSHPFS
EVNETFNFKSTRLAKFIKSNDKLNSSKLRITSQENKTE
NT seq 4437 nt   +upstreamnt  +downstreamnt
atgccctttttgaggaaaatagcggggacagcacatacacattctaggtctgattcgaac
tcatctgtgaaattcggccatcagccgactagttcggtagcatcaaccaaaagttcaagc
aaaagccctcgtgcaacatctcgcaaaagcatttatgatgatattagaagccaatttccc
aacctaacccccaactctacctcttctcagttttacgaaagcacgccagttatcgaacaa
tcctttaattggacgacagatgaccacatctcagctggaacgcttgaaaacccaacgagc
tttacaaacagttcttataaaaatgacaatggacctagtagcctctctgattcgaggaaa
tcctccggtggcaatagcgtaaatagtttgtcctttgacaagctaattctatcgtgggat
cctacagaccctgatgaatggacaatgcatcgcgtcacctcatggtttaaatttcatgat
tttccagaatcctggatattgtttttcaaaaagcatcaattgtttggtcacagatttata
aagttgcttgcatatgataatttcgctgtttatgaaaagtatttgccgcagactaaaact
gcttcatataccaggtttcagcagttattgaaaaaaacaatgaccaagaacgtaacaaat
agccatattcgtcagaagagcgctagcaaacttaaaagttccaggtcttccagcgaatcg
atcaaatcaaaattaaaaaatagtaaatcgcaagaggatatttcaaattctagatcaacg
tcagaatctgcattgagcccaacaaaatcgggcccttccaagaccgatgaaaagaatttt
ttacattctacttcaacacaccaaaaaaccaaaagcgcaagttcactatacagaagaagt
tttatatccctaagaggctcatcatcgagcaatgcttcctcagcaaaatcaccttcaaac
atcaagttaagtataccggctcggccgcactcaattattgaatctaacagtacacttacc
aaatcggcgagcccacctgcatctccttcgtatcctagcatatttagaagacatcacaaa
agtagttcatctgagtcgtcattattaaattccctttttggtagtggaataggcgaggaa
gctccaacaaagcctaatccacaaggtcatagtctgtctagtgaaaatttagctaaagga
aaatctaaacactatgaaactaatgtgtcttcacctttaaaacaatcttcactacccact
tcggatgataaaggtaatttatggaataaattcaaaagaaagagccaaataggggttcct
agcccaaatacggtagcttatgtaacgtctcaagaaactccatccttaaaatcgaattcg
agtactgctaccttaaccgtacaaacggcagatgtaaatataccatctccatcttcatca
ccaccgccaatacccaaaactgcaaacagaagtttggaggtcatcagcacagaagataca
cctaaaatttcttcaaccacggcgtcttttaaagaaacgtatcctgattgtattaatcca
gacaagacagttccagtgccggtaaataatcaaaagtatagtgtaaagaactttttactg
gaccaaaaattttatcctctgaagaaaacagggttaaatgatagtgagaataaatatatt
ctggttaccaaagataatgttagttttgttccgctaaacttaaaaagtgtagcaaaatta
tccagtttcaaagaatctgctctcacaaaattgggaatcaatcacaaaaatgtcactttc
catatgacagactttgattgcgatattggtgctgcaattccagatgatactttggaattt
ttgaaaaaaagcttgtttttgaacacttctggaaaaatttatatcaaagaccaaatgaag
cttcaacaaaaaccgaaacctgctcctctcacctcagaaaacaatgttcctttaaaatcg
gtgaaaagtaagagttcaatgaggtccggaacaagcagtctgatagcatcgacagatgat
gtttccattgtcacttcgtcttctgacataacatcatttgatgaacatgcatcaggaagt
gggcgcaggtacccccaaaccccgagttattactatgacagagtttccaatactaatcca
actgaagaattgaattattggaatattaaagaagttctttctcatgaggaaaatgcacca
aaaatggtttttaaaacaagtccaaaattagaactcaacctaccagataaaggaagtaaa
ttaaatattcctacccccataacagaaaatgaaagcaagagtagttttcaagtgctaaga
aaagatgaggggactgaaattgatttcaatcatcgtagggaatcgccttatacaaaacca
gaactggcaccaaaaagagaagctcccaagcctcccgcaaatacttctcctcagaggacc
ttatcaacttctaaacagaataaaccgatccgcctagtgagggcaagtacaaaaatttcg
agaagcaaaagatcgaaaccattgccgccacaattattatcatctcctatagaagctagc
agctcgtctcctgattcgcttacttcctcatatactcctgcttcgactcatgttttgata
ccgcaaccttataagggtgcaaacgatgttatgcgtaggttgaaaacagaccaggactcg
acgagtacttccccatctttgaaaatgaaacagaaagtgaatcgctcaaattcaactgta
tcgacttcaaattcaattttctattctccttcaccattgttaaaaagaggtaactcaaaa
agagttgtttcgtcgacatctgcggccgatatatttgaagagaatgacataacattcgcg
gatgctccgccgatgtttgacagcgatgatagtgatgacgattctagttcatccgatgac
attatctggtccaagaaaaaaacagctcctgagactaataatgaaaacaaaaaggatgag
aaaagcgataacagttctacgcattctgacgaaatattctatgattctcaaacgcaggac
aaaatggagagaaagatgacctttagaccatctccggaggtcgtttatcaaaatttagag
aaattcttcccaagggctaacttagataagccaatcactgaaggaatagcttcaccaaca
tctccgaaatccttagacagcctactttcaccaaagaatgtggcttcatcgagaactgag
ccaagcactccttcccgtcccgtccctcctgatagctcatacgagttcatacaggatgga
cttaacggtaaaaataaaccattgaatcaagctaagacacctaaaagaacaaaaaccata
agaaccattgcacatgaagctagtttagcaagaaaaaactctgtaaaactaaaaagacag
aacaccaaaatgtggggtacaagaatggtcgaagtgaccgaaaaccatatggtgtcaatt
aataaagccaaaaattcgaaaggtgagtataaggaattcgcctggatgaagggtgaaatg
atagggaagggatctttcggtgctgtttatttatgtttaaacgttactacaggtgagatg
atggccgttaagcaggttgaggtccccaagtatagctcacaaaatgaagccattctaagt
accgtggaagcattaagatctgaagtgtccacgttaaaagatttagatcatcttaatatt
gttcaatacttaggttttgagaataaaaacaatatttacagtttgtttttagaatatgtt
gctggtggctccgtgggatccttgattagaatgtatggaagattcgatgaaccgttgatc
aaacatttaacaacacaagtattaaaaggattggcatacctacactcgaaaggtattctc
cacagggatatgaaggcagacaacttacttttggatcaagatggtatctgcaaaatcagt
gacttcggaatttcaagaaaatcaaaggacatatactctaattcggatatgaccatgcga
ggaacagtcttctggatggctcctgaaatggttgatacaaagcaaggctacagtgcaaaa
gttgatatatggtctctgggatgcatcgttctggaaatgtttgctggtaagcgcccgtgg
tccaacttagaagtcgtcgcagccatgttcaaaattggaaagtcaaaatcggcaccacca
attcctgaggacactttaccattgatatcgcaaatcggacgaaattttctggacgcatgc
ttcgagataaatccagagaaaaggccaaccgctaacgagcttctttctcatccttttagt
gaagtaaatgaaacattcaatttcaaatctaccagactcgcgaagtttataaagtcaaat
gataagttaaactcttcaaaattaaggataacctctcaggagaataaaactgaatag

DBGET integrated database retrieval system