KEGG   Saccharomyces cerevisiae (budding yeast): YJL138C
Entry
YJL138C           CDS       T00005                                 

Gene name
TIF2
Definition
(RefSeq) translation initiation factor eIF4A
  KO
K03257  translation initiation factor 4A
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YJL138C (TIF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YJL138C (TIF2)
   03012 Translation factors [BR:sce03012]
    YJL138C (TIF2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YJL138C (TIF2)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     YJL138C (TIF2)
   mRNA cycle factors
    Stress granule specific factors
     YJL138C (TIF2)
Translation factors [BR:sce03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    YJL138C (TIF2)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YJL138C (TIF2)
  Exosomal proteins of bladder cancer cells
   YJL138C (TIF2)
SSDB
Motif
Pfam: DEAD Helicase_C ResIII AAA_19 AAA_30
Other DBs
NCBI-GeneID: 853303
NCBI-ProteinID: NP_012397
SGD: S000003674
UniProt: P10081
Structure
PDB: 

Position
X:complement(153504..154691)
AA seq 395 aa
MSEGITDIEESQIQTNYDKVVYKFDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGH
DVLAQAQSGTGKTGTFSIAALQRIDTSVKAPQALMLAPTRELALQIQKVVMALAFHMDIK
VHACIGGTSFVEDAEGLRDAQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGF
KEQIYQIFTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVN
VEEEEYKYECLTDLYDSISVTQAVIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERD
TIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRGGRFGRKGVA
INFVTNEDVGAMRELEKFYSTQIEELPSDIATLLN
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgtctgaaggtattactgatattgaagaatcccaaattcaaaccaactatgacaaggtc
gtctacaagttcgatgatatggaattggacgaaaacttgttaagaggtgttttcggttac
ggtttcgaagaaccatctgccattcaacaacgtgccatcatgcctattattgaaggtcac
gatgtcttggctcaagctcaatctggtactggtaagaccggtactttctccattgctgct
ttgcaaagaattgacacctctgtcaaggctcctcaagctttgatgttggctccaactaga
gaattggctttgcaaatccaaaaggttgtcatggctttggctttccacatggacatcaag
gtccacgcttgtatcggtggtacttcctttgttgaagacgctgaaggtttgagagatgct
caaatcgtcgttggtactccaggtcgtgtttttgacaacatccaaagacgtagattcaga
actgacaagatcaagatgttcatcttagatgaagctgatgaaatgttgtcttctggtttc
aaggaacaaatctaccaaattttcaccttacttccaccaaccactcaagttgttctattg
tccgccaccatgccaaatgacgtcttggaagttaccaccaaatttatgagaaacccagtt
agaattttggttaagaaggatgaattgactttggaaggtatcaaacaattctacgttaat
gttgaagaagaagaatacaaatacgagtgtttgaccgatttatacgactctatctccgtt
actcaagctgtcatcttctgtaacaccagaagaaaggtcgaagaattgaccactaagtta
agaaacgacaaatttaccgtttctgccatctattctgatttaccacaacaagaaagagac
accatcatgaaggaattcagaagtggttcttccagaattttgatctccactgatttgttg
gctagaggtatcgatgtccaacaagtttctttggttattaactacgacttaccagctaac
aaagaaaactatattcacagaatcggtagaggtggtcgtttcggtagaaagggtgttgcc
atcaactttgttactaacgaagacgttggcgctatgagagaactagaaaagttctactcc
actcaaattgaagaattgccatccgacattgctaccttgttgaactaa

KEGG   Saccharomyces cerevisiae (budding yeast): YKR059W
Entry
YKR059W           CDS       T00005                                 

Gene name
TIF1
Definition
(RefSeq) translation initiation factor eIF4A
  KO
K03257  translation initiation factor 4A
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YKR059W (TIF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YKR059W (TIF1)
   03012 Translation factors [BR:sce03012]
    YKR059W (TIF1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YKR059W (TIF1)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     YKR059W (TIF1)
   mRNA cycle factors
    Stress granule specific factors
     YKR059W (TIF1)
Translation factors [BR:sce03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    YKR059W (TIF1)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YKR059W (TIF1)
  Exosomal proteins of bladder cancer cells
   YKR059W (TIF1)
SSDB
Motif
Pfam: DEAD Helicase_C ResIII AAA_19 AAA_30
Other DBs
NCBI-GeneID: 853933
NCBI-ProteinID: NP_012985
SGD: S000001767
UniProt: P10081
Structure
PDB: 

Position
XI:554987..556174
AA seq 395 aa
MSEGITDIEESQIQTNYDKVVYKFDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGH
DVLAQAQSGTGKTGTFSIAALQRIDTSVKAPQALMLAPTRELALQIQKVVMALAFHMDIK
VHACIGGTSFVEDAEGLRDAQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGF
KEQIYQIFTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVN
VEEEEYKYECLTDLYDSISVTQAVIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERD
TIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRGGRFGRKGVA
INFVTNEDVGAMRELEKFYSTQIEELPSDIATLLN
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgtctgaaggtattactgatattgaagaatcccaaattcaaaccaactatgacaaggtt
gtctacaagttcgatgatatggaattggacgaaaacttgttaagaggtgttttcggttac
ggtttcgaagaaccatctgccattcaacaacgtgccatcatgcctattattgaaggtcac
gatgtcttggctcaagctcaatctggtactggtaagaccggtaccttttccattgctgct
ttgcaaagaattgacacctctgtcaaggctcctcaagctttgatgttggctccaactaga
gaattggctttgcaaatccaaaaggttgtcatggctttggctttccacatggacatcaag
gtccacgcttgtatcggtggtacttcctttgttgaagacgctgaaggtttgagagatgct
caaatcgtcgttggtactccaggtcgtgtttttgacaacatccaaagacgtagattcaga
actgacaagatcaagatgttcatcttagatgaagctgatgaaatgttgtcttctggtttc
aaggaacaaatctaccaaattttcaccttacttccaccaaccactcaagttgttctattg
tccgccaccatgccaaatgacgtcttggaagttaccaccaaatttatgagaaacccagtt
agaattttggttaagaaggatgaattgactttggaaggtatcaaacaattctacgttaat
gttgaagaagaagaatacaaatacgagtgtttgaccgatttatacgactctatctccgtt
actcaagctgtcatcttctgtaacaccagaagaaaggtcgaagaattgaccactaagtta
agaaacgacaaatttaccgtttctgccatctactctgatttaccacaacaagaaagagac
accatcatgaaggaattcagaagtggttcttccagaattttgatctccactgatttgttg
gctagaggtatcgatgtccaacaagtttctttggttattaactacgacttaccagctaac
aaagaaaactatattcacagaatcggtagaggtggtcgtttcggtagaaagggtgttgcc
atcaactttgttactaacgaagacgttggcgctatgagagaactagaaaagttctactcc
actcaaattgaagaattgccatccgacatcgctactttgttgaactaa

DBGET integrated database retrieval system