KEGG   Saccharomyces cerevisiae (budding yeast): YJR042W
Entry
YJR042W           CDS       T00005                                 

Gene name
NUP85, RAT9
Definition
(RefSeq) Nup85p
  KO
K14304  nuclear pore complex protein Nup85
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YJR042W (NUP85)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YJR042W (NUP85)
   03036 Chromosome and associated proteins [BR:sce03036]
    YJR042W (NUP85)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     YJR042W (NUP85)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    YJR042W (NUP85)
SSDB
Motif
Pfam: Nucleopor_Nup85
Other DBs
NCBI-GeneID: 853499
NCBI-ProteinID: NP_012576
SGD: S000003803
UniProt: P46673
Structure
PDB: 

Position
X:514055..516289
AA seq 744 aa
MTIDDSNRLLMDVDQFDFLDDGTAQLSNNKTDEEEQLYKRDPVSGAILVPMTVNDQPIEK
NGDKMPLKFKLGPLSYQNMAFITAKDKYKLYPVRIPRLDTSKEFSAYVSGLFEIYRDLGD
DRVFNVPTIGVVNSNFAKEHNATVNLAMEAILNELEVFIGRVKDQDGRVNRFYELEESLT
VLNCLRTMYFILDGQDVEENRSEFIESLLNWINRSDGEPDEEYIEQVFSVKDSTAGKKVF
ETQYFWKLLNQLVLRGLLSQAIGCIERSDLLPYLSDTCAVSFDAVSDSIELLKQYPKDSS
STFREWKNLVLKLSQAFGSSATDISGELRDYIEDFLLVIGGNQRKILQYSRTWYESFCGF
LLYYIPSLELSAEYLQMSLEANVVDITNDWEQPCVDIISGKIHSILPVMESLDSCTAAFT
AMICEAKGLIENIFEGEKNSDDYSNEDNEMLEDLFSYRNGMASYMLNSFAFELCSLGDKE
LWPVAIGLIALSATGTRSAKKMVIAELLPHYPFVTNDDIEWMLSICVEWRLPEIAKEIYT
TLGNQMLSAHNIIESIANFSRAGKYELVKSYSWLLFEASCMEGQKLDDPVLNAIVSKNSP
AEDDVIIPQDILDCVVTNSMRQTLAPYAVLSQFYELRDREDWGQALRLLLLLIEFPYLPK
HYLVLLVAKFLYPIFLLDDKKLMDEDSVATVIEVIETKWDDADEKSSNLYETIIEADKSL
PSSMATLLKNLRKKLNFKLCQAFM
NT seq 2235 nt   +upstreamnt  +downstreamnt
atgacaatcgatgattcaaatcgattacttatggacgtcgatcaatttgattttttggac
gacggaacggcgcaacttagtaataacaagaccgatgaagaagaacaactatataaaagg
gacccagtcagcggggctatcctggtccctatgactgtaaatgatcaaccgattgaaaaa
aatggcgacaagatgcctttaaagttcaagctggggccactttcttaccaaaatatggca
ttcataactgcaaaagataaatataagctttatcctgttagaattcctagattagatacc
agcaaagagttttctgcatacgtatcaggtttatttgaaatttaccgtgatttaggtgat
gacagagtgtttaatgtaccaacgattggagttgttaattctaatttcgcgaaggagcat
aatgcaacagtaaatctggccatggaggcgattctgaatgaattggaagtgtttattggt
agagtcaaggatcaggatggaagagtgaaccgattttatgagttggaagaatctttaacc
gttttaaactgtctgaggacaatgtacttcatattagatggtcaggatgtagaggagaac
agatcagagtttattgagtcattgctaaactggattaatagatcagacggtgaaccagat
gaagaatatattgaacaagtgttttcagtgaaggattctacagcaggtaaaaaagtgttc
gaaacacaatatttctggaagcttttgaatcagcttgttttaagaggcctgctctcccaa
gctataggttgcattgaaagatcagatcttttaccatatttgagtgatacatgtgccgtt
tcatttgatgcagtaagtgactccatcgaactcctgaaacaatatccaaaagattcgtcc
agtacatttagagaatggaaaaatttggtgctaaaattaagtcaagcctttggtagttct
gctactgatatttccggtgaattacgggattacattgaagatttcttgttagtaattggt
ggaaatcaacgaaaaattctgcagtattcaaggacgtggtatgagtccttttgtgggttt
ttattatactatatcccctcattagaactatcagcagaatatttacaaatgtcactggaa
gctaacgtcgtagacataacaaatgattgggaacaaccatgcgtcgacatcattagtggt
aagatacactcaattttaccggtaatggaatctttagatagttgcacagcagcatttacc
gctatgatttgtgaagcaaaaggtttgatagagaatatttttgagggtgaaaaaaatagc
gatgattatagtaatgaagacaacgaaatgcttgaagatctattctcttataggaatggt
atggcatcttatatgctaaatagcttcgcttttgagttgtgttcactgggtgataaggaa
ctatggcccgttgccattggattgatagccttatctgcaacagggacgagaagtgcaaag
aaaatggtgattgcagaattacttccacactacccatttgttacgaatgatgacattgaa
tggatgctaagtatatgtgtagaatggagactaccagaaatagcgaaggaaatatacacc
acgttgggtaatcaaatgttatcggcacacaacataattgaaagtatcgcaaattttagt
agggcgggcaaatatgaactggtaaagtcatattcgtggctattatttgaagcttcgtgc
atggagggccagaagttggacgaccctgtgttgaatgccattgtgagcaaaaactctcct
gcagaggatgacgttataataccacaagacattttagattgtgtagtgacgaattctatg
cgtcaaactttagcgccatatgctgttctgtcacaattctatgagctgagggacagagaa
gattggggccaagcgctgcgcctattgcttttgctgattgaattcccttatttaccaaaa
cattacttggttttgcttgtggcgaaattcctgtacccaattttccttttagatgataag
aagctaatggatgaagattcagtggcgacagtcattgaagttatagaaactaaatgggat
gacgctgatgaaaaaagttcaaacttatatgaaaccattattgaagcagataaaagctta
cctagtagcatggcaacacttttgaaaaatttaagaaagaaactaaatttcaaattatgt
caagcgttcatgtaa

DBGET integrated database retrieval system