KEGG   Saccharomyces cerevisiae (budding yeast): YKL068W
Entry
YKL068W           CDS       T00005                                 

Gene name
NUP100, NSP100
Definition
(RefSeq) FG-nucleoporin NUP100
  KO
K14297  nuclear pore complex protein Nup98-Nup96
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YKL068W (NUP100)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YKL068W (NUP100)
   03036 Chromosome and associated proteins [BR:sce03036]
    YKL068W (NUP100)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     YKL068W (NUP100)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    YKL068W (NUP100)
SSDB
Motif
Pfam: Nucleoporin_FG Nucleoporin2
Other DBs
NCBI-GeneID: 853796
NCBI-ProteinID: NP_012855
SGD: S000001551
UniProt: Q02629
Position
XI:310199..313078
AA seq 959 aa
MFGNNRPMFGGSNLSFGSNTSSFGGQQSQQPNSLFGNSNNNNNSTSNNAQSGFGGFTSAA
GSNSNSLFGNNNTQNNGAFGQSMGATQNSPFGSLNSSNASNGNTFGGSSSMGSFGGNTNN
AFNNNSNSTNSPFGFNKPNTGGTLFGSQNNNSAGTSSLFGGQSTSTTGTFGNTGSSFGTG
LNGNGSNIFGAGNNSQSNTTGSLFGNQQSSAFGTNNQQGSLFGQQSQNTNNAFGNQNQLG
GSSFGSKPVGSGSLFGQSNNTLGNTTNNRNGLFGQMNSSNQGSSNSGLFGQNSMNSSTQG
VFGQNNNQMQINGNNNNSLFGKANTFSNSASGGLFGQNNQQQGSGLFGQNSQTSGSSGLF
GQNNQKQPNTFTQSNTGIGLFGQNNNQQQQSTGLFGAKPAGTTGSLFGGNSSTQPNSLFG
TTNVPTSNTQSQQGNSLFGATKLTNMPFGGNPTANQSGSGNSLFGTKPASTTGSLFGNNT
ASTTVPSTNGLFGNNANNSTSTTNTGLFGAKPDSQSKPALGGGLFGNSNSNSSTIGQNKP
VFGGTTQNTGLFGATGTNSSAVGSTGKLFGQNNNTLNVGTQNVPPVNNTTQNALLGTTAV
PSLQQAPVTNEQLFSKISIPNSITNPVKATTSKVNADMKRNSSLTSAYRLAPKPLFAPSS
NGDAKFQKWGKTLERSDRGSSTSNSITDPESSYLNSNDLLFDPDRRYLKHLVIKNNKNLN
VINHNDDEASKVKLVTFTTESASKDDQASSSIAASKLTEKAHSPQTDLKDDHDESTPDPQ
SKSPNGSTSIPMIENEKISSKVPGLLSNDVTFFKNNYYISPSIETLGNKSLIELRKINNL
VIGHRNYGKVEFLEPVDLLNTPLDTLCGDLVTFGPKSCSIYENCSIKPEKGEGINVRCRV
TLYSCFPIDKETRKPIKNITHPLLKRSIAKLKENPVYKFESYDPVTGTYSYTIDHPVLT
NT seq 2880 nt   +upstreamnt  +downstreamnt
atgtttggcaacaatagaccaatgtttggagggagcaacctttcctttggatcaaatacg
tcatccttcggtgggcaacaatcgcaacaaccaaactctctttttggaaatagcaataac
aacaacaattccaccagtaacaatgcccaatcaggatttggtggattcacttctgccgct
ggcagtaatagtaacagtttatttggaaataacaatactcaaaataatggggcatttggc
cagtcaatgggtgccacccaaaactcaccatttgggtcgttaaactcctcaaatgccagt
aatgggaacacttttggaggatccagttcaatgggttcttttggtggtaataccaataat
gcatttaataataacagtaacagtaccaattccccgtttggtttcaataaaccgaataca
ggagggaccttgtttggttcgcagaataataatagtgcaggtacttctagtttatttggc
ggccaaagtacaagtaccactggcacattcggaaacaccggaagtagtttcggaacaggc
ttaaatggcaacggctctaacatatttggggcagggaacaactcacaaagcaatactacc
ggcagcttgtttggcaaccaacaatcttcagcgtttgggacaaataatcaacaaggaagt
ctatttggacagcaatctcaaaacaccaataatgcgtttggtaatcaaaatcagctgggg
ggcagttccttcggatcaaaaccagttggttcagggtcgctgtttggccagagcaacaac
actttaggtaatacaaccaataatagaaatggattgtttggtcaaatgaattccagtaac
caaggcagttctaacagtggattgtttggacaaaactcgatgaacagcagcactcaaggg
gtatttggacaaaacaataatcaaatgcaaattaatggcaataacaacaacagtttattt
ggaaaggcaaacaccttttcaaattccgcatcaggaggtttatttggccaaaataatcaa
cagcaagggtccgggctgtttggtcaaaattctcagacaagcggtagtagtggacttttt
gggcagaataatcagaaacagcccaatacttttacccaatctaatacaggaataggtctc
tttggacagaacaacaaccagcaacaacaatctacaggtttgtttggagccaaaccagca
ggtaccacaggatctcttttcggtggtaattcatcaacccagcctaactctcttttcggt
actaccaatgtacctacctctaatacacagtcacaacaaggaaatagtctttttggtgcc
acgaagctgaccaacatgccctttggaggaaatcccactgcaaaccagtcagggagtgga
aacagtctattcggaactaaacctgcctccactaccggctcattatttggaaacaacaca
gcttctacgacagtaccttccacgaatggattgtttggtaacaacgctaacaattcaact
agcactacgaatacgggacttttcggtgcaaagcctgattctcagtccaaacctgcatta
gggggagggttattcggcaattcaaactcgaattcttccacaatcggccaaaacaaacca
gtttttggaggcacaacccaaaatacaggactctttggcgccaccggcacgaactcttca
gcagttggttcaactggtaaactttttggccagaataataatacgcttaatgttggtaca
caaaatgtaccacctgtgaacaataccacccaaaacgcccttttgggtacaacggcagtt
ccttccctacaacaagccccagtaactaatgaacagcttttttccaaaatatcaatccct
aactctattacaaatccagttaaagcaacaacttcaaaagtgaacgcagatatgaaaaga
aatagtagcctcacgtctgcctatagacttgccccaaagccgttatttgctccctcttcg
aatggcgatgctaaatttcaaaagtggggcaagacactggaaagaagtgatagaggaagc
agtaccagcaattctattacggacccagaatcaagctatctaaattcaaacgacttgttg
tttgatccagatagaagatatttgaaacatctggtgattaaaaataataagaacttaaat
gtcattaaccataatgatgatgaagcaagcaaagttaaattagtgacgtttacaacagaa
tcagcttcaaaagatgaccaagcctcatcaagcattgctgcttcaaaattaactgaaaaa
gcacattctcctcagactgacctaaaagatgatcatgatgaaagcactcctgatcctcaa
tcgaaatctccaaatggttccacctctataccaatgattgagaatgaaaagattagcagc
aaagttcccggcctattgagcaacgacgttacctttttcaagaataactactacatttca
ccttccatagaaacgcttggcaataagtcattaattgaacttcgtaaaataaacaaccta
gtcattggtcacagaaattatggtaaagtcgagtttctggagcccgttgatttgttgaat
actcctttggatactttatgcggggatcttgtcacctttggaccaaaatcatgttcaata
tatgaaaactgttccataaagccagaaaagggcgaaggcattaatgtacgttgtagagtg
actttatattcctgttttcctattgacaaagaaacaaggaaacctataaagaatataaca
catcctctactgaaaagaagtatagccaaactaaaagaaaacccagtgtacaagtttgaa
agctatgaccccgtaacaggcacctatagttacaccatagatcacccagttttaacttaa

KEGG   Saccharomyces cerevisiae (budding yeast): YMR047C
Entry
YMR047C           CDS       T00005                                 

Gene name
NUP116, NSP116
Definition
(RefSeq) FG-nucleoporin NUP116
  KO
K14297  nuclear pore complex protein Nup98-Nup96
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YMR047C (NUP116)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YMR047C (NUP116)
   03036 Chromosome and associated proteins [BR:sce03036]
    YMR047C (NUP116)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     YMR047C (NUP116)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    YMR047C (NUP116)
SSDB
Motif
Pfam: Nucleoporin2 Nucleoporin_FG
Other DBs
NCBI-GeneID: 855066
NCBI-ProteinID: NP_013762
SGD: S000004650
UniProt: Q02630
Structure
PDB: 
3PBP 2AIV

Position
XIII:complement(363364..366705)
AA seq 1113 aa
MFGVSRGAFPSATTQPFGSTGSTFGGQQQQQQPVANTSAFGLSQQTNTTQAPAFGNFGNQ
TSNSPFGMSGSTTANGTPFGQSQLTNNNASGSIFGGMGNNTALSAGSASVVPNSTAGTSI
KPFTTFEEKDPTTGVINVFQSITCMPEYRNFSFEELRFQDYQAGRKFGTSQNGTGTTFNN
PQGTTNTGFGIMGNNNSTTSATTGGLFGQKPATGMFGTGTGSGGGFGSGATNSTGLFGSS
TNLSGNSAFGANKPATSGGLFGNTTNNPTNGTNNTGLFGQQNSNTNGGLFGQQQNSFGAN
NVSNGGAFGQVNRGAFPQQQTQQGSGGIFGQSNANANGGAFGQQQGTGALFGAKPASGGL
FGQSAGSKAFGMNTNPTGTTGGLFGQTNQQQSGGGLFGQQQNSNAGGLFGQNNQSQNQSG
LFGQQNSSNAFGQPQQQGGLFGSKPAGGLFGQQQGASTFASGNAQNNSIFGQNNQQQQST
GGLFGQQNNQSQSQPGGLFGQTNQNNNQPFGQNGLQQPQQNNSLFGAKPTGFGNTSLFSN
STTNQSNGISGNNLQQQSGGLFQNKQQPASGGLFGSKPSNTVGGGLFGNNQVANQNNPAS
TSGGLFGSKPATGSLFGGTNSTAPNASSGGIFGSNNASNTAATTNSTGLFGNKPVGAGAS
TSAGGLFGNNNNSSLNNSNGSTGLFGSNNTSQSTNAGGLFQNNTSTNTSGGGLFSQPSQS
MAQSQNALQQQQQQQRLQIQNNNPYGTNELFSKATVTNTVSYPIQPSATKIKADERKKAS
LTNAYKMIPKTLFTAKLKTNNSVMDKAQIKVDPKLSISIDKKNNQIAISNQQEENLDESI
LKASELLFNPDKRSFKNLINNRKMLIASEEKNNGSQNNDMNFKSKSEEQETILGKPKMDE
KETANGGERMVLSSKNDGEDSATKHHSRNMDEENKENVADLQKQEYSEDDKKAVFADVAE
KDASFINENYYISPSLDTLSSYSLLQLRKVPHLVVGHKSYGKIEFLEPVDLAGIPLTSLG
GVIITFEPKTCIIYANLPNRPKRGEGINVRARITCFNCYPVDKSTRKPIKDPNHQLVKRH
IERLKKNPNSKFESYDADSGTYVFIVNHAAEQT
NT seq 3342 nt   +upstreamnt  +downstreamnt
atgtttggagttagccgtggcgcattccccagcgcaacaacacagccatttggctcaaca
ggatcaacctttggtggccaacagcaacaacaacaaccagtagcaaacacttctgctttc
ggcctcagtcagcaaacaaatacaacacaagcacctgcgtttggtaactttggtaaccaa
acttctaattctcccttcggaatgtcaggctcgactacagcaaatggtactccttttggt
caaagtcaattgacgaacaacaatgcctctggctcgatcttcggtggaatgggtaataac
acagcactttctgctggttccgcttctgttgtgcccaattctactgcaggtacaagcatt
aaaccttttactacattcgaagagaaggatccaaccacaggtgtcatcaacgtcttccaa
agtatcacctgtatgcctgaatacagaaatttttcttttgaagaattgagatttcaagat
taccaagctggtagaaaattcggtaccagtcaaaatggcactggtactacttttaacaat
cctcaaggaactaccaatactggatttggaattatgggtaataataactccactacttct
gctacaacaggaggattatttggtcaaaagccagcaacaggcatgtttggaaccggaact
ggaagtggtggtggctttggctctggagcgaccaactctacaggattgtttggaagctct
actaacctctcaggaaattctgcatttggagcaaataaacctgccacttccgggggattg
tttggtaatacaactaacaacccaacaaacggcactaataatacaggccttttcggccag
cagaactcaaatacaaacggaggattatttggtcaacagcaaaattcatttggggcgaat
aatgtcagtaacgggggagcctttggtcaggtgaatcgtggtgcctttccccaacaacaa
acacaacaaggtagtggtggtatatttggtcaatcaaacgctaacgcaaatggtggcgct
ttcggccaacagcaaggcactggtgctctttttggagctaaacctgcttctggtggacta
tttggacaatctgctggttcaaaagcattcggaatgaataccaaccccactggtaccact
ggtggcttatttgggcaaaccaatcagcagcaaagtggaggagggttatttggccagcaa
caaaattccaacgctggaggattgttcggtcagaataaccaaagccagaaccaatccgga
ttatttggacaacaaaactcctcaaacgcatttggccagccacagcaacaaggcggatta
tttggaagcaaacctgcaggaggactgtttggacaacagcagggagcatccacttttgcg
tctggtaatgcccaaaataattctatatttgggcaaaataaccaacaacagcaatcaacc
gggggattattcggacaacaaaacaaccagtcgcagtcccaacctggtggattgtttggc
cagaccaatcaaaataataatcagccatttggccaaaatgggttacaacaaccacaacag
aataatagtctttttggagcgaaaccaactggttttggaaatacaagcttattctctaac
agcacaacaaatcaaagtaacggtataagtggaaataatttgcagcagcaatcaggaggt
ttgttccaaaataaacagcaacctgcttcgggtggcctgtttggttcaaaaccatcaaac
actgttggaggcggattatttggaaacaatcaagttgcaaatcaaaacaatcctgcctca
actagcggcggattatttggtagcaaacctgctacaggatcccttttcggaggtactaat
tccacggctccaaacgcctcttcgggtggaatatttgggtccaataatgcatctaacacg
gcggccaccaccaattctactggtttatttggtaataaaccagttggtgcgggagcttct
acaagtgctggaggactatttggaaacaataacaactcgtctctaaacaattccaacggt
tcaacgggcctgtttggtagtaataacacctctcaatctactaatgctggaggcttattt
cagaataacactagtacgaacacttcgggcggagggttattttcccaaccttcccagtca
atggcacaatcacaaaatgcgctccaacaacagcagcagcaacaacgattacaaattcag
aataacaatccctacggtactaatgagcttttttcgaaagcaactgtcaccaacacggtt
tcctatccaattcaaccaagcgctacaaagatcaaagccgatgaacgcaaaaaagccagt
ttgacgaacgcatacaaaatgattcctaaaactttatttacagccaagctcaagactaat
aattccgtcatggataaggcccagatcaaggttgatccaaagttgtcgatttccattgat
aaaaagaataatcagattgcgatttctaaccagcaggaggaaaatttggacgaaagcata
ttaaaagcttctgagttattattcaatcccgataaaaggtcattcaagaatctaattaat
aacaggaaaatgttgatcgcatccgaggaaaagaataacggatcacagaacaacgatatg
aattttaaaagtaaaagtgaagaacaagaaacgatcttgggaaagccaaagatggatgaa
aaagaaactgctaatgggggggaaagaatggttttgtcctcaaagaacgatggggaagat
agcgcaacgaaacatcattcccggaatatggacgaagaaaataaagaaaatgtcgccgat
ttacagaagcaagaatattcagaagatgataaaaaggctgtttttgcggacgttgcggaa
aaagatgcctccttcattaatgagaactactatatctcaccatccctggacacattatcc
tcttattctctcttgcaactgcgcaaagttcctcatttagttgtgggtcataaaagttat
ggtaaaattgaatttcttgaacctgttgacctcgctggaattcctttgacctcattaggg
ggcgtaatcattacttttgaaccaaaaacctgtataatatatgcgaacttaccaaacaga
ccgaagagaggggagggcattaatgttcgggccaggattacctgctttaactgttatcct
gtagacaaatctaccagaaaacctataaaggatccaaatcatcaactggttaaaaggcat
atcgaacgcttaaagaaaaatccaaattctaagttcgaaagctatgatgcagacagtggt
acatacgtgtttatcgtaaaccacgctgcagagcagacctga

DBGET integrated database retrieval system