KEGG   Saccharomyces cerevisiae (budding yeast): YKL205W
Entry
YKL205W           CDS       T00005                                 

Gene name
LOS1
Definition
(RefSeq) Ran GTPase-binding protein LOS1
  KO
K14288  exportin-T
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YKL205W (LOS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sce03016]
    YKL205W (LOS1)
Transfer RNA biogenesis [BR:sce03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    YKL205W (LOS1)
SSDB
Motif
Pfam: Exportin-T Xpo1 Glyco_hydro_5_C
Other DBs
NCBI-GeneID: 853630
NCBI-ProteinID: NP_012717
SGD: S000001688
UniProt: P33418
Position
XI:50051..53353
AA seq 1100 aa
MLERIQQLVNAVNDPRSDVATKRQAIELLNGIKSSENALEIFISLVINENSNDLLKFYGL
STLIELMTEGVNANPNGLNLVKFEITKWLKFQVLGNKQTKLPDFLMNKISEVLTTLFMLM
YSDCNGNQWNSFFDDLMSLFQVDSAISNTSPSTDGNILLGLEFFNKLCLMINSEIADQSF
IRSKESQLKNNNIKDWMRDNDIMKLSNVWFQCLKLDEQIVSQCPGLINSTLDCIGSFISW
IDINLIIDANNYYLQLIYKFLNLKETKISCYNCILAIISKKMKPMDKLAFLNMINLTNEL
TYYHQAISMNPQIITFDNLEVWESLTKLITSFGIEFTIIIEQVNDDQKLDTLYKQSVISN
VDSILLEKIIPILLEFMNNEFDSITAKTFPFWSNYLAFLKKYKASSPNFVPLHKDFLDNF
QQICFKRMKFSDDEVTQDDFEEFNETVRFKLKNFQEIIVVIDPSLFLNNISQEISANLMN
CKNESWQIFELTIYQIFNLSECTKNNYFGLNKNEIMTSQPSLTLVRFLNELLMMKDFLLA
IDNEQIQILFMELIVKNYNFIFSTSANTANATDDDEKYLLILNIFMSSFAMFNKRENVRL
RSWYLFTRFLKLTRINLKKILFANKNLVNEITNKISPLLHIKVTSINAQGTDDNDTIFDN
QLYIFEGIGFIITLNNSSQELTAATANTPIDYDILDQILTPLFTQLEGCITQGASPVVIL
ECHHILMAIGTLARGLHIGLVPENQVNNMVVNKKLINDSLIHKFSNIAEVILVTFSFFNK
FENIRDASRFTFARLIPILSNKILPFINKLIELILSSTDLKSWEMIDFLGFLSQLIHMFH
TDTDCYQLFNQLLTPLINKVHSIIEEIDEQHDQQSSSNKPIDTAVTATSVNKNIVVTDSY
RDKILLKKAYCTFLQSFTNNSVTSILLSDINRAILPVILNDLVTYTPQEIQETSMMKVSL
NVLCNFIKCFGNGTCLDNDDINKDPNLKIDGLNEYFIMKCVPIIFEIPFNPIYKFNIKEG
NFKTMAYDLARLLRELFIVSSNPTTNENECVKYLTQIYLPQIQLPQELTIQLVNMLTTMG
QKQFEKWFVDNFISVLKQGQ
NT seq 3303 nt   +upstreamnt  +downstreamnt
atgctagaacggattcagcagctggtaaatgcagtgaacgatccacgctcagatgtggcc
actaagagacaagccatcgagctgctaaatgggattaaatcatcagagaatgcattggaa
atctttatatcattggtcatcaacgagaattcaaatgatttgttgaagttttacggactg
tccacattgatagaattgatgacggagggcgtgaacgctaatccaaatggtttgaatctg
gtaaagtttgaaataaccaaatggctcaaatttcaagttttgggcaataagcaaactaag
ctgcctgactttttaatgaataagatttctgaagtgctgactactttgtttatgttaatg
tacagtgattgtaatggaaaccagtggaacagtttttttgacgatctgatgagtctattc
caagtggattcggctatttccaatacgagcccgtctaccgatggtaacattcttctaggt
cttgaattttttaacaagctctgtttgatgattaattcggagattgctgaccaaagcttt
attaggtctaaggaatctcagttaaaaaataacaatataaaagattggatgcgtgataac
gatatcatgaaattgagtaatgtgtggtttcagtgtttaaaactggacgaacaaattgtg
tcacaatgtcccggattgatcaattctaccttggattgtattgggagttttatctcatgg
atcgatattaatttaattattgatgcaaataattattatctgcaattaatctataaattt
ttaaatcttaaagaaaccaaaatttcatgttataattgcatactggccatcatctctaaa
aaaatgaaaccaatggacaaactggcttttctgaatatgatcaatttgaccaacgaattg
acttactatcatcaagccatatcaatgaatccccaaattattacatttgataatttagaa
gtctgggaaagtttgaccaagttgattacttcctttggcatagaatttactatcattatt
gaacaagtcaacgatgatcaaaaattggatacattatacaaacaatcggtcatttcaaat
gttgattccatattattggagaaaataataccaatacttttggaatttatgaataatgag
tttgattcaataacagcaaaaaccttcccattctggtcaaattatctggctttcttgaaa
aaatataaagcatcttcaccaaattttgtaccattgcataaggattttctagataatttc
caacaaatttgctttaaaagaatgaagttttcagacgacgaggtcacacaggatgatttt
gaggaattcaacgaaaccgtaagatttaaattaaaaaatttccaggagatcatcgtggta
attgacccaagtctgtttttaaataacatttctcaagaaatttcagcaaacctaatgaat
tgtaaaaacgaaagctggcaaattttcgagctaactatttatcaaatcttcaatttaagt
gaatgtaccaagaacaactatttcggtttgaacaagaatgaaattatgacctcacaacct
tcgctaactttagtacgatttttaaatgaattgttaatgatgaaggatttcttattagcc
attgataacgaacaaatccaaatactattcatggaattaattgtgaaaaactacaatttc
atattttcaactagtgctaacacagcaaatgctactgatgatgatgaaaagtatctatta
atattgaatattttcatgagctcatttgctatgttcaataaaagagaaaacgtcagacta
aggtcatggtatttatttacaagattcttgaagttgacaagaatcaatttgaaaaaaatc
ctctttgccaacaaaaatttggttaatgaaataactaataagataagtcctctacttcac
ataaaagtaacatctatcaacgcccaagggacggatgacaatgatacaatttttgataat
cagttgtacatatttgagggtattgggtttataatcacattgaataatagcagtcaggag
ctcactgctgccactgccaacacccccatcgattacgatatattggaccagatattaact
ccgctatttacacaattagagggttgtattacccaaggagcttcgccagttgtgattctg
gaatgtcatcacattcttatggctattggtactttagcgagaggtttgcacattggtctc
gtccctgagaatcaggtcaacaatatggttgtcaacaaaaaattaatcaatgactcttta
atccataaattctctaatatagctgaggttatattagtaacattctcttttttcaataag
ttcgaaaatatccgcgatgcatctaggtttacctttgccaggttaattccaattttaagt
aataaaattttaccatttatcaataaattgattgaattgatcttatcgtccacagattta
aaatcatgggagatgattgattttcttgggttcttatctcaactgattcatatgtttcac
acggacacagactgttatcagctgtttaaccagttacttactccgcttatcaacaaagtc
cattctattatcgaagagattgatgaacaacacgaccaacaatcaagcagtaacaaacct
atagacactgcagtcacagccacctccgtaaataagaatatcgtggtcaccgattcgtat
agagataaaatactattgaaaaaggcttactgcacatttttacagtcatttactaataat
tccgtcacttcgatactattgtcagatataaacagagcaatcctgccggtcatattaaac
gatttggtcacctatacgccgcaagagatccaggaaacatcaatgatgaaagtgtcactc
aatgtattgtgcaattttatcaaatgttttgggaatgggacctgcttggataatgacgac
atcaataaagatcccaaccttaaaatagatggtctcaacgaatacttcatcatgaaatgt
gtcccaataatctttgaaattccgttcaatccaatatacaagttcaatatcaaagaaggg
aatttcaaaacaatggcatatgatttggcaagattactgagggagctatttatcgtcagc
agcaaccccaccacaaatgagaatgaatgtgtaaaatatttaactcagatctaccttcca
caaatccaattaccacaggaattgacgattcagttggttaatatgttaaccacaatgggt
caaaagcaattcgaaaaatggtttgtagataatttcatttctgttttaaagcaaggtcaa
tag

DBGET integrated database retrieval system