KEGG   Saccharomyces cerevisiae (budding yeast): YKR079C
Entry
YKR079C           CDS       T00005                                 

Gene name
TRZ1
Definition
(RefSeq) tRNase Z
  KO
K00784  ribonuclease Z [EC:3.1.26.11]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YKR079C (TRZ1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sce03016]
    YKR079C (TRZ1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.11  tRNase Z
     YKR079C (TRZ1)
Transfer RNA biogenesis [BR:sce03016]
 Eukaryotic type
  3'processing and CCA adding factors
   3'processing factors
    YKR079C (TRZ1)
 Prokaryotic type
    YKR079C (TRZ1)
SSDB
Motif
Pfam: Lactamase_B_4 Lactamase_B_2 LD_cluster2
Other DBs
NCBI-GeneID: 853954
NCBI-ProteinID: NP_013005
SGD: S000001787
UniProt: P36159
Structure
PDB: 
5MTZ

Position
XI:complement(586789..589305)
AA seq 838 aa
MFTFIPITHPTSDTKHPLLLVQSAHGEKYFFGKIGEGSQRSLTENKIRISKLKDIFLTGE
LNWSDIGGLPGMILTIADQGKSNLVLHYGNDILNYIVSTWRYFVFRFGIDLNDHIMKDKE
VYKDKIIAVKSFNVLKNGGEDRLGVFDSFQKGVLRSIVAKMFPKHAPTDRYDPSSDPHLN
VELPDLDAKVEVSTNYEISFSPVRGKFKVEEAIKLGVPKGPLFAKLTKGQTITLDNGIVV
TPEQVLENERHFAKVLILDIPDDLYLNAFVEKFKDYDCAELGMVYYFLGDEVTINDNLFA
FIDIFEKNNYGKVNHMISHNKISPNTISFFGSALTTLKLKALQVNNYNLPKTDRVFSKDF
YDRFDTPLSRGTSMCKSQEEPLNTIIEKDNIHIFSQNKTVTFEPFRMNEEPMKCNINGEV
ADFSWQEIFEEHVKPLEFPLADVDTVINNQLHVDNFNNSAEKKKHVEIITLGTGSALPSK
YRNVVSTLVKVPFTDADGNTINRNIMLDAGENTLGTIHRMFSQLAVKSIFQDLKMIYLSH
LHADHHLGIISVLNEWYKYNKDDETSYIYVVTPWQYHKFVNEWLVLENKEILKRIKYISC
EHFINDSFVRMQTQSVPLAEFNEILKENSNQESNRKLELDRDSSYRDVDLIRQMYEDLSI
EYFQTCRAIHCDWAYSNSITFRMDENNEHNTFKVSYSGDTRPNIEKFSLEIGYNSDLLIH
EATLENQLLEDAVKKKHCTINEAIGVSNKMNARKLILTHFSQRYPKLPQLDNNIDVMARE
FCFAFDSMIVDYEKIGEQQRIFPLLNKAFVEEKEEEEDVDDVESVQDLEVKLKKHKKN
NT seq 2517 nt   +upstreamnt  +downstreamnt
atgttcacatttatacccatcacccatcctacatcggatacaaagcacccattgctgcta
gtccagtctgcacatggggaaaagtatttcttcggtaaaattggtgaaggatcccaaagg
agtctgactgaaaataagatcaggatatccaaattgaaggatattttccttactggtgaa
ttaaactggtcagatataggtggattacctggaatgattttgactattgctgatcaaggg
aaaagtaatcttgttttgcattacggcaatgacattttgaattacatagtttccacttgg
agatacttcgtctttagattcggaatagacttgaacgatcacattatgaaagacaaggaa
gtatataaagataagataatagctgttaaatcctttaatgttctgaaaaatgggggggaa
gacaggttaggcgtcttcgatagttttcaaaaaggtgtattacgttccatagtagcaaaa
atgttccccaaacatgcacccaccgataggtacgatccttctagtgatccgcacttgaat
gtagagttgcctgacttagacgccaaagtggaagtttctacgaattacgagatttcattc
agtccagtgaggggtaaatttaaagtggaggaagctattaaactaggtgttccgaagggt
cccttatttgcaaagttaaccaagggccaaacaattactttggataacggtattgttgta
actccggaacaggtattggagaatgaacgtcattttgccaaagtattgatcctggatatc
ccagatgacctatatttgaacgctttcgtagaaaaattcaaggattatgattgtgctgag
cttggcatggtgtattattttcttggtgatgaggttaccattaatgataatctattcgcg
ttcattgacatatttgagaaaaacaattatggtaaagtaaatcatatgatatcccacaat
aaaatttctccaaacacgatatcatttttcggttctgcattgaccacattgaaattaaag
gcactacaagtaaataattacaatttaccaaaaacagatcgtgtgttttccaaggacttc
tacgacagattcgatacaccactcagcagaggtacatctatgtgtaaatcccaggaagag
cctttgaatacaataatagagaaggataacattcatattttttcacaaaacaagacagta
actttcgaaccatttcggatgaacgaagaaccgatgaaatgcaacatcaacggtgaagtg
gcggatttctcgtggcaagaaattttcgaagaacatgtaaaaccattagaatttccctta
gctgatgtcgatacagttatcaataatcaactacacgtggataactttaacaattcagca
gaaaagaagaaacacgttgaaattatcaccttaggaaccggtagtgcattgccttctaaa
tatagaaacgttgtctccacacttgttaaagttccttttactgacgccgatggaaatacc
ataaatagaaacattatgctagatgctggtgaaaatactttaggtaccatacacaggatg
ttttctcagctagcagtcaagtcaatatttcaggatttgaaaatgatatatctgagtcac
ttgcatgcagaccaccatttgggaataatcagcgtgctaaatgaatggtacaaatataac
aaggatgatgaaacgagttatatatatgtggttactccatggcaatatcacaaatttgtt
aatgaatggttagttctagaaaataaagagattttaaagagaatcaaatacataagttgt
gagcatttcatcaatgattcgtttgtaagaatgcagacacaatctgttcctttggcagag
ttcaatgaaatattgaaagaaaatagcaatcaagaatcaaacagaaaactggaactggat
agagattcttcatatagggatgttgacttgatcagacaaatgtatgaggatttatcgata
gaatattttcaaacttgcagagctatacattgtgactgggcatattcgaactcaattacc
ttccgaatggacgaaaacaatgagcataatacattcaaggtttcatattcaggcgataca
agacctaacatcgagaaattttccctcgaaataggctataattcagatctattaattcac
gaagctacactagaaaatcagctactggaggatgccgtgaagaaaaaacactgcactatt
aatgaagcaatcggtgtttcgaacaaaatgaatgctaggaagttgatcttaacacacttt
tcccagagatatcccaaattgccccaattagacaataatattgatgtgatggcgagagaa
ttttgttttgctttcgacagtatgatcgttgattatgagaaaattggtgaacagcagcgt
atttttccactgctgaataaggcatttgttgaagaaaaggaagaagaagaagatgttgat
gacgttgaaagcgtacaagatttggaagtcaaacttaagaaacacaagaaaaattag

DBGET integrated database retrieval system